changeset 56819:2938e0a4e954

8232734: [TESTBUG] avoid using JDK symbols in ExtraSymbols.symbols.txt Reviewed-by: ccheung
author iklam
date Mon, 04 Nov 2019 12:36:54 -0800
parents d67ebc838ab8
children c41d1303a87c
files test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.symbols.txt test/lib/jdk/test/lib/cds/CDSTestUtils.java
diffstat 3 files changed, 89 insertions(+), 10829 deletions(-) [+]
line wrap: on
line diff
--- a/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java	Mon Nov 04 11:42:24 2019 -0800
+++ b/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java	Mon Nov 04 12:36:54 2019 -0800
@@ -34,6 +34,7 @@
 
 import java.io.*;
 import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.cds.CDSTestUtils;
 
 public class ExtraSymbols {
     static final String CDS_LOGGING = "-Xlog:cds,cds+hashtables";
@@ -46,10 +47,9 @@
         checkOutput(output);
         int numEntries1 = numOfEntries(output);
 
-        // 2. Dump an archive with extra symbols. All symbols in
-        // ExtraSymbols.symbols.txt are valid. Dumping should succeed.
+        // 2. Dump an archive with lots of extra symbols.
         output = TestCommon.dump(appJar, TestCommon.list("Hello"), CDS_LOGGING,
-            "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("ExtraSymbols.symbols.txt"));
+            "-XX:SharedArchiveConfigFile=" + makeLotsExtraSymbols());
         checkOutput(output);
         int numEntries2 = numOfEntries(output);
         if (numEntries2 <= numEntries1) {
@@ -86,4 +86,30 @@
         output.shouldContain("Shared symbol table stats -------- base:");
         output.shouldHaveExitValue(0);
     }
+
+    static String makeLotsExtraSymbols() throws Exception {
+        String fileName = "LotsExtraSymbols.txt";
+        File f = new File(fileName);
+        try (FileWriter fw = new FileWriter(f)) {
+            fw.write("VERSION: 1.0\n");
+            fw.write("@SECTION: Symbol\n");
+            appendSymbol(fw, "This file is auto-generated by test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java. Do not edit.");
+            appendSymbol(fw, "Hello");
+            appendSymbol(fw, ""); // empty string
+            appendSymbol(fw, "Hello_\u0001");   // <128 escaping with \x
+            appendSymbol(fw, "Hello_\u00ff");   // <256 escaping with \x
+            appendSymbol(fw, "Hello_\u1234");   // >= 256 escaping with \x
+            appendSymbol(fw, "Hello_\uffff");   // >= 256 escaping with \x
+
+            for (int i = 0; i < 10000; i++) {
+                appendSymbol(fw, "NewSymbol" + Integer.toString(i));
+            }
+        }
+        return fileName;
+    }
+
+    private static void appendSymbol(FileWriter fw, String symbol) throws Exception {
+        fw.write(CDSTestUtils.formatArchiveConfigSymbol(symbol));
+        fw.write("\n");
+    }
 }
--- a/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.symbols.txt	Mon Nov 04 11:42:24 2019 -0800
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,10826 +0,0 @@
-VERSION: 1.0
-@SECTION: Symbol
-69 -1: ------------------------------------------------------------123456789
-68 -1: # The values in this file are only used for testing the operation of
-63 -1: # adding extra symbols into the CDS archive. None of the values
-70 -1: # are interpreted in any way. So even if they contain names of classes
-70 -1: # that have been renamed or removed, or string literals that have been
-66 -1: # changed or remove from Java source code, it would not affect the
-26 -1: # correctness of the test.
-0 -1: 
-41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
-11 -1: linkMethod 
-18 -1: type can't be null
-20 -1: isAlphaNumericString
-43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z
-72 -1: (Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
-1 -1: \t
-15 -1: IntCumulateTask
-1 -1: \n
-33 -1: java/util/Locale$LocaleNameGetter
-23 -1: sun/invoke/util/Wrapper
-57 -1: (Ljava/io/InputStream;Ljava/nio/charset/CharsetDecoder;)V
-12 -1: reduceToLong
-11 -1: setReadOnly
-34 -1: (Ljava/lang/reflect/Executable;)[B
-54 -1: ([Ljava/net/URL;Ljava/security/AccessControlContext;)V
-15 -1: LegacyMergeSort
-8 -1: endsWith
-55 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;TT;)V
-20 -1: createAnnotationData
-6 -1: OfLong
-90 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;)Ljava/util/Map<TK;TV;>;
-1 -1:  
-17 -1: getClassSignature
-1 -1: "
-1 -1: #
-1 -1: (
-21 -1: MethodHandleImpl.java
-10 -1: getUTF8At0
-1 -1: )
-1 -1: *
-1 -1: +
-1 -1: ,
-1 -1: -
-1 -1: .
-18 -1: unsignedEntryNames
-1 -1: /
-1 -1: 0
-19 -1: java/io/InputStream
-38 -1: java/util/concurrent/ThreadLocalRandom
-1 -1: :
-1 -1: ;
-1 -1: <
-13 -1: getAndAddLong
-1 -1: =
-1 -1: >
-1 -1: ?
-20 -1: getMethodAtIfLoaded0
-1 -1: @
-1 -1: A
-7 -1: isAlive
-1 -1: B
-10 -1: checkIndex
-1 -1: C
-1 -1: D
-1 -1: E
-1 -1: F
-1 -1: I
-30 -1: sun/misc/JavaUtilZipFileAccess
-11 -1: classloader
-1 -1: J
-1 -1: L
-14 -1: packageEnabled
-8 -1: ([BIII)V
-24 -1: Ljava/io/BufferedWriter;
-1 -1: S
-32 -1: (Ljava/util/function/Consumer;)V
-11 -1: refKindName
-1 -1: U
-1 -1: V
-3 1: yyy
-18 -1: JavaNetAccess.java
-1 -1: Z
-7 -1: members
-1 -1: [
-1 -1: ]
-13 -1: ShortLanguage
-1 -1: _
-9 -1: invoke__L
-28 -1: (D)Ljava/lang/StringBuilder;
-15 -1: isInvokeSpecial
-1 -1: c
-17 -1: subListRangeCheck
-1 -1: e
-29 -1: Ljava/security/AllPermission;
-27 -1: (C)Ljava/lang/StringBuffer;
-28 -1: ([Ljava/lang/Comparable;II)V
-50 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/Inflater;)V
-9 -1: invoke__V
-1 -1: m
-101 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)Lsun/nio/cs/StreamEncoder;
-13 -1: MAX_SURROGATE
-18 -1: Ljava/lang/String;
-21 -1: ensureProtectedAccess
-18 -1: getIfModifiedSince
-1 -1: r
-9 -1: setExtra0
-1 -1: s
-47 -1: Ljava/lang/Enum<Lsun/launcher/LauncherHelper;>;
-1 -1: x
-1 -1: {
-7 -1: getLast
-1 -1: |
-1 -1: }
-1 -1: ~
-71 -1: (Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-34 -1: (Ljava/nio/charset/Charset;[BII)[C
-10 -1: DST_NSHIFT
-25 -1: ForEachTransformedKeyTask
-26 -1: Ljava/nio/charset/Charset;
-56 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/MethodAccessor;
-22 -1: StackTraceElement.java
-24 -1: sun.zip.zipFile.openTime
-27 -1: JNI_COPY_TO_ARRAY_THRESHOLD
-26 -1: java/lang/ClassValue$Entry
-19 -1: [Ljava/lang/Thread;
-56 -1: (Ljava/lang/ClassLoader$NativeLibrary;)Ljava/lang/Class;
-7 -1: message
-18 -1: parameterToArgSlot
-20 -1: [[Ljava/lang/String;
-11 -1: bumpVersion
-26 -1: Ljava/lang/reflect/Method;
-9 -1: getMethod
-6 -1: (I)TE;
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MemberName;
-33 -1: sun/misc/URLClassPath$JarLoader$1
-57 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)V
-33 -1: sun/misc/URLClassPath$JarLoader$2
-33 -1: sun/misc/URLClassPath$JarLoader$3
-87 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
-19 -1: FileDescriptor.java
-12 -1: forEachValue
-36 -1: (Ljava/util/List;)[Ljava/lang/Class;
-53 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuilder;
-8 -1: hasArray
-4 -1: ROWS
-10 -1: linkMethod
-9 -1: remaining
-23 -1: ARRAY_FLOAT_BASE_OFFSET
-35 -1: java/lang/reflect/ReflectPermission
-24 -1: ()Ljava/net/InetAddress;
-7 -1: ngroups
-81 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Class<*>;>;
-10 -1: putTreeVal
-4 -1: list
-5 -1: trace
-7 -1: blocker
-21 -1: reset() not supported
-8 -1: JAPANESE
-11 -1: PRIVATE_USE
-53 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
-32 -1: Invalid JavaFX launch parameters
-15 -1: SECONDS_PER_DAY
-11 -1: UTF_16.java
-24 -1: sun/nio/cs/UTF_8$Encoder
-102 -1: (Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
-20 -1: (Lsun/misc/Signal;)V
-22 -1: MagicAccessorImpl.java
-84 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class;
-14 -1: altMetafactory
-13 -1: queryOverflow
-30 -1:  exists, but is not accessible
-3 -1: edt
-14 -1: MAX_ARRAY_SIZE
-20 -1: aliases_UTF_16LE_BOM
-34 -1: Ljava/lang/reflect/Constructor<*>;
-20 -1: (S)Ljava/lang/Short;
-6 -1: STRICT
-19 -1: internalCallerClass
-27 -1: java/nio/DirectLongBufferRU
-13 -1: TIMED_WAITING
-15 -1: toGenericString
-6 -1: client
-10 -1: attachImpl
-22 -1: ReflectionFactory.java
-8 -1: jsse.jar
-37 -1: (IZ)Ljava/lang/AbstractStringBuilder;
-41 -1: java/util/LinkedHashMap$LinkedKeyIterator
-15 -1: computeIfAbsent
-10 -1: GET_TARGET
-53 -1: <E:Ljava/lang/Enum<TE;>;>(Ljava/lang/Class<TE;>;)[TE;
-35 -1: java/util/Collections$SingletonList
-7 -1: addYear
-35 -1: Ljava/lang/Class<Ljava/lang/Byte;>;
-65 -1: (Ljava/util/LinkedHashMap$Entry;Ljava/util/LinkedHashMap$Entry;)V
-14 -1: image/x-bitmap
-10 -1: (IIII[JI)V
-50 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)V
-13 -1: getLineNumber
-20 -1: toUpperCaseCharArray
-62 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection;
-11 -1: rotateRight
-10 -1: checkPtype
-85 -1: (JLjava/util/function/ToLongFunction<-TK;>;JLjava/util/function/LongBinaryOperator;)J
-81 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
-15 -1: Illegal style: 
-28 -1: (Ljava/lang/StringBuilder;)V
-41 -1: 1.8.0-internal-iklam_2013_11_27_21_25-b00
-25 -1: Invalid authority field: 
-55 -1: (Ljava/lang/CharSequence;)Ljava/util/function/Supplier;
-12 -1: staticOffset
-32 -1: java/util/HashMap$KeySpliterator
-13 -1: javaNioAccess
-24 -1: (Ljava/util/SortedSet;)V
-17 -1: thenComparingLong
-2 -1: \n\n
-22 -1: registerFieldsToFilter
-34 -1: java/lang/invoke/LambdaMetafactory
-225 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask;Ljava/util/function/BiFunction;Ljava/util/function/BiFunction;)V
-26 -1: [[Ljava/lang/CharSequence;
-32 -1: java/util/Collections$CheckedMap
-147 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSequentialList<TE;>;Ljava/util/List<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-204 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/CallSite;
-27 -1: sun/nio/cs/UTF_16BE$Decoder
-12 -1: getZoneInfo0
-77 -1: (Ljava/lang/Class;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-9 -1: Traverser
-35 -1: Ljava/lang/ref/ReferenceQueue<TT;>;
-27 -1: lambda$comparing$ea9a8b3a$1
-7 -1: ([CI)[C
-6 -1: getenv
-9 -1: newMethod
-52 -1: <T:Ljava/lang/Object;>Ljava/lang/reflect/Executable;
-164 -1: (Ljava/security/ProtectionDomain;Ljava/security/DomainCombiner;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
-40 -1: (Ljava/lang/String;)Ljava/util/TimeZone;
-11 -1: countTokens
-202 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;Ljava/util/Map$Entry<TK;TV;>;>;Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;Ljava/io/Serializable;
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Collection<TT;>;
-34 -1: (Ljava/lang/reflect/Constructor;)I
-15 -1: comparingDouble
-24 -1: ()Ljava/util/Collection;
-14 -1: invokeFinalize
-14 -1: encodeISOArray
-77 -1: (Ljava/lang/ref/Reference;Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
-11 -1: bad index: 
-34 -1: (Ljava/lang/reflect/Constructor;)V
-68 -1: (Ljava/util/jar/JarEntry;Lsun/security/util/ManifestEntryVerifier;)V
-53 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJ)V
-27 -1: ([CII)Ljava/nio/CharBuffer;
-6 -1: setOut
-41 -1: (ILjava/lang/Object;Ljava/lang/Object;I)V
-12 -1: MIN_EXPONENT
-30 -1: PrivilegedExceptionAction.java
-18 -1: key cannot be null
-6 -1: CENHDR
-73 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-23 -1: java/lang/reflect/Array
-8 -1: AF_LIMIT
-2 -1: \r\n
-11 -1: getFileName
-10 -1: parseShort
-22 -1: java/lang/LinkageError
-15 -1: FT_LAST_WRAPPER
-32 -1: java/util/ArrayDeque$DeqIterator
-24 -1: pc-multilingual-850+euro
-3 -1: zfc
-14 -1: incrementExact
-38 -1: (IIII)Lsun/util/calendar/CalendarDate;
-8 -1: (II[BI)V
-8 -1: isLocked
-13 -1: ZoneInfo.java
-36 -1: (Lsun/util/calendar/CalendarDate;J)V
-35 -1: java/lang/invoke/MethodHandleImpl$1
-31 -1: (Ljava/util/Comparator<-TE;>;)V
-19 -1: CharsetEncoder.java
-52 -1: <T:Ljava/lang/Object;>()Ljava/util/Enumeration<TT;>;
-44 -1: (Ljava/io/InputStream;)Ljava/io/InputStream;
-7 -1:  field 
-5 -1: abort
-25 -1: java/lang/SecurityManager
-66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask
-1316 -1: \xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8c\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe2\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x15\xee\xa0\x80\x16\xe6\xa0\x80\x18\xe2\x80\x80\x19\xe3\xa0\x80\x18\xe2\x80\x80\x14\xe3\xa0\x80\x18\xe3\xa0\x80\x18\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe3\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x19\xe6\xa0\x80\x19\xee\xa0\x80\x19\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xee\xa0\x80\x15\xe6\xa0\x80\x18\xee\xa0\x80\x16\xe6\xa0\x80\x1b\xe6\xa0\x80\xe5\x80\x97\xe6\xa0\x80\x1b\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xee\xa0\x80\x15\xe6\xa0\x80\x19\xee\xa0\x80\x16\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe3\xa0\x80\x0c\xe6\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe6\xa0\x80\x1c\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe6\xa0\x80\x1c\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1d\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x90\xe6\xa0\x80\x1c\xe6\xa0\x80\x1b\xe2\xa0\x80\x1c\xe2\xa0\x80\x19\xe1\xa0\x80\xd8\x8b\xe1\xa0\x80\xd8\x8b\xe6\xa0\x80\x1b\xdf\xbd\xe7\x80\x82\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe1\xa0\x80\xd4\x8b\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1e\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\x18\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xe6\xa0\x80\x19\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xdf\xbd\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xe6\xa0\x80\x19\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xd8\x9d\xe7\x80\x82
-6 -1: (J[I)I
-162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/util/Locale;>;
-21 -1: getQualifiedFieldName
-46 -1: Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
-47 -1: (Ljava/util/Collection;Ljava/util/Collection;)Z
-10 -1: getRuntime
-30 -1: threadLocalRandomSecondarySeed
-18 -1: (Ljava/io/File;I)J
-10 -1: methodName
-34 -1: sun/reflect/generics/tree/TypeTree
-35 -1: (Ljava/io/File;)[Ljava/lang/String;
-31 -1: java/util/Collections$EmptyList
-15 -1: LF_INVINTERFACE
-9 -1: notifyAll
-18 -1: (Ljava/io/File;I)V
-94 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
-45 -1: (Ljava/lang/String;)Ljava/net/ContentHandler;
-3 -1: enc
-3 -1: end
-18 -1: (Ljava/io/File;I)Z
-47 -1: (Ljava/lang/Object;Ljava/lang/reflect/Method;)V
-76 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Z)V
-19 -1: getURLStreamHandler
-46 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class<*>;)V
-17 -1: COMPILE_THRESHOLD
-15 -1: charset is null
-7 -1: ibm-912
-10 -1: basicTypes
-7 -1: ibm-914
-78 -1: (Ljava/lang/Class;Ljava/lang/ref/SoftReference;Ljava/lang/ref/SoftReference;)Z
-7 -1: ibm-915
-12 -1: JarFileEntry
-12 -1: setThreshold
-22 -1: (ILjava/lang/Object;)V
-55 -1: <T::Lsun/reflect/generics/tree/Tree;>Ljava/lang/Object;
-16 -1: Unknown signal: 
-3 -1: zip
-13 -1: CR_UNMAPPABLE
-19 -1: getClassAtIfLoaded0
-21 -1: WindowsClientCounters
-29 -1: Ljava/lang/invoke/MethodType;
-91 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableList<TE;>;Ljava/util/RandomAccess;
-23 -1: StackOverflowError.java
-13 -1: Launcher.java
-9 -1: Signature
-7 -1: ibm-920
-153 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-13 -1: setExtensions
-26 -1: [Ljava/lang/ref/Reference;
-7 -1: ibm-923
-12 -1: BMH.reinvoke
-34 -1: java/lang/IllegalArgumentException
-53 -1: (Ljava/lang/String;)Ljava/lang/NumberFormatException;
-5 -1: .dirs
-13 -1: finishToArray
-22 -1: (ZI)Ljava/lang/String;
-84 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/RuntimeException;
-15 -1: charsetProvider
-24 -1: ()Ljava/lang/Class<TT;>;
-10 -1: wordsInUse
-26 -1: (Ljava/io/ExpiringCache;)I
-53 -1: ()Ljava/util/Iterator<Ljava/util/Map$Entry<TK;TV;>;>;
-25 -1: com/sun/management/GcInfo
-26 -1: getCompatibilityExtensions
-69 -1: (Ljava/lang/ref/ReferenceQueue;Ljava/util/concurrent/ConcurrentMap;)V
-15 -1: getConstantPool
-24 -1: [[Ljava/lang/Comparable;
-26 -1: (Ljava/io/ExpiringCache;)V
-8 -1: getTable
-53 -1: sun/reflect/generics/repository/ConstructorRepository
-5 -1: range
-36 -1: (Ljava/lang/String;)Ljava/lang/Byte;
-72 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;)V
-60 -1: <T:Ljava/lang/Object;>([TT;TT;Ljava/util/Comparator<-TT;>;)I
-20 -1: (Ljava/nio/Bits$1;)V
-30 -1: ()Ljava/util/Spliterator<TK;>;
-6 -1: ([BB)I
-53 -1: (Ljava/lang/ref/Finalizer;Lsun/misc/JavaLangAccess;)V
-11 -1: memberTypes
-45 -1: (ILjava/lang/String;)Ljava/lang/StringBuffer;
-12 -1: OTHER_SYMBOL
-65 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-43 -1: (Ljava/util/Set;)[Ljava/lang/reflect/Field;
-30 -1: (Ljava/lang/ref/Reference$1;)V
-18 -1: GREGORIAN_INSTANCE
-31 -1: Ljava/lang/FunctionalInterface;
-57 -1: (Ljava/lang/Error;Ljava/lang/Exception;)Ljava/lang/Error;
-54 -1: ([Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-14 -1: not an array: 
-6 -1: ([BB)V
-9 -1: ISO8859_1
-8 -1: addTrans
-27 -1: getFunctionalInterfaceClass
-29 -1: lambda$comparingInt$7b0bb60$1
-8 -1: TreeNode
-138 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/Dictionary<TK;TV;>;Ljava/util/Map<TK;TV;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-3 -1: era
-22 -1: fakeMethodHandleInvoke
-9 -1: addToList
-39 -1: (Ljava/lang/Class;[Ljava/lang/String;)V
-17 -1: launchApplication
-21 -1: randomNumberGenerator
-51 -1: Ljava/lang/ThreadLocal<Ljava/lang/ThreadLocal<*>;>;
-35 -1: java/io/ObjectOutputStream$PutField
-42 -1: (ILjava/util/function/IntBinaryOperator;)I
-3 -1: err
-13 -1: cachedDecoder
-32 -1: sun/util/calendar/ZoneInfoFile$1
-23 -1: doIntersectionPrivilege
-19 -1: cspc850multilingual
-56 -1: Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
-11 -1: loader_data
-27 -1: (Ljava/util/jar/Manifest;)V
-5 -1: files
-90 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Lsun/util/calendar/CalendarSystem;>;
-36 -1: [[Ljava/lang/invoke/LambdaForm$Name;
-5 -1: lines
-55 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/MetaIndex;
-9 -1: ansi-1251
-15 -1: refKindIsMethod
-29 -1: java/lang/reflect/Constructor
-3 -1: est
-19 -1: Lsun/misc/Launcher;
-109 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;)TT;
-10 -1: getOffsets
-9 -1: removeAll
-23 -1: java/util/regex/Matcher
-8 -1: sumCount
-7 -1: implies
-10 -1: MAIN_CLASS
-75 -1: (Ljava/util/List<Lsun/launcher/LauncherHelper$StdArg;>;)[Ljava/lang/String;
-11 -1: getISO3Code
-4 -1: high
-53 -1: (TK;Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)TV;
-17 -1: setNormalizedDate
-23 -1: AbstractRepository.java
-28 -1: java/util/LinkedList$ListItr
-8 -1: isFrozen
-38 -1: (Ljava/lang/String;Z)Ljava/lang/Class;
-16 -1: ReflectUtil.java
-30 -1: ()Ljava/util/stream/IntStream;
-57 -1: (Ljava/lang/Object;JLjava/lang/Object;)Ljava/lang/Object;
-11 -1: getResource
-16 -1: ThreadDeath.java
-24 -1: unmodifiableNavigableSet
-59 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Ljava/net/URL;>;
-24 -1: java.security.auth.debug
-58 -1: (Ljava/io/FileInputStream;)Ljava/nio/channels/FileChannel;
-25 -1: ()Ljava/util/Enumeration;
-11 -1: getInstance
-6 -1: MONDAY
-15 -1: jdkMinorVersion
-16 -1: newThreadWithAcc
-6 -1: CENHOW
-32 -1:     Max. Heap Size (Estimated): 
-61 -1: (Ljava/lang/invoke/MethodType;Z)Ljava/lang/invoke/LambdaForm;
-11 -1: windows-932
-7 -1: Index: 
-11 -1: composeList
-6 -1: utf-16
-6 -1: ibm437
-10 -1: getJarFile
-8 -1: , rem = 
-13 -1: multiNewArray
-14 -1: getDefaultPort
-39 -1: Ljava/security/cert/CertificateFactory;
-10 -1: L_RESERVED
-19 -1: getMethodAtIfLoaded
-8 -1: needCast
-8 -1: IS_FIELD
-15 -1: ClassValue.java
-31 -1: ()Ljava/util/function/Supplier;
-125 -1: (Ljava/lang/Class<*>;)Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-34 -1: lambda$comparingByValue$827a17d5$1
-4 -1: NONE
-21 -1: java/nio/DoubleBuffer
-33 -1: ()Lsun/reflect/LangReflectAccess;
-26 -1: invalid compression method
-6 -1: (TK;)Z
-16 -1: FT_UNCHECKED_REF
-14 -1: getGenericType
-17 -1: pathSeparatorChar
-8 -1: writeUTF
-8 -1: NO_PROXY
-188 -1: (Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
-13 -1: finalRefCount
-12 -1: NF_checkCast
-6 -1: utf-32
-26 -1: (Ljava/util/ArrayDeque;I)Z
-19 -1: prefetchWriteStatic
-14 -1: computeInvoker
-5 -1:  cap=
-19 -1: generateCertificate
-15 -1: methodModifiers
-3 -1: exc
-27 -1: ()Lsun/misc/JavaLangAccess;
-5 -1: State
-14 -1: NullComparator
-10 -1: getClassAt
-15 -1: printProperties
-110 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor;
-40 -1: (Ljava/util/List<*>;Ljava/util/Random;)V
-63 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/reflect/Method;>;
-28 -1: (I)Ljava/lang/StringBuilder;
-48 -1: ([DIILjava/util/function/DoubleBinaryOperator;)V
-3 -1: exp
-11 -1: interpret_L
-17 -1: Serializable.java
-8 -1: FJDouble
-12 -1: HashMap.java
-9 -1: sys_paths
-17 -1: getMainAttributes
-14 -1: asDoubleBuffer
-10 -1: buildNames
-26 -1: TOPLEVEL_WINDOW_PERMISSION
-4 -1: Type
-31 -1: (Ljava/util/Collection<+TE;>;)V
-64 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class<*>;
-100 -1: <E:Ljava/lang/Object;>(Ljava/util/Collection<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Collection<TE;>;
-10 -1: checkError
-31 -1: (Ljava/util/Collection<+TE;>;)Z
-31 -1: java/lang/NoSuchMethodException
-6 -1: attach
-87 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-9 -1: writeChar
-44 -1: java/util/ArraysParallelSortHelpers$FJObject
-34 -1: (Ljava/lang/Class;Ljava/io/File;)Z
-21 -1: java/util/zip/ZipFile
-5 -1: dirty
-6 -1: (JIZ)V
-12 -1: leftoverChar
-39 -1:  is being loaded in another classloader
-10 -1: writeBytes
-6 -1: unlink
-41 -1: (TT;Ljava/lang/ref/ReferenceQueue<TT;>;)V
-21 -1: getBootstrapResources
-95 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/io/Serializable;
-10 -1: PathStatus
-25 -1: java/io/InputStreamReader
-15 -1: ISO_8859-9:1989
-37 -1: java/lang/ExceptionInInitializerError
-14 -1: exceptionTypes
-19 -1: BufferedReader.java
-34 -1: Could not create SecurityManager: 
-13 -1: definePackage
-12 -1: getAndAddInt
-50 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-30 -1: (Ljava/lang/SecurityManager;)V
-12 -1: fxLaunchName
-22 -1: BINARYSEARCH_THRESHOLD
-29 -1: JVMTI_THREAD_STATE_TERMINATED
-9 -1: fullFence
-60 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Ljava/net/URL;>;
-29 -1: java/lang/Thread$WeakClassKey
-47 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;)V
-8 -1: (TV;)TV;
-60 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;I)V
-47 -1: java/security/cert/CertificateEncodingException
-12 -1: BA_DIRECTORY
-53 -1: (Ljava/lang/Class;ZLjava/lang/Class;)Ljava/util/List;
-9 -1: checkRead
-6 -1: <init>
-4 -1: args
-17 -1: genericMethodType
-10 -1: writeFloat
-26 -1: Can't handle static method
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MethodType;
-22 -1: MapReduceKeysToIntTask
-17 -1: jvm_micro_version
-29 -1: (Ljava/util/Map<+TK;+TV;>;Z)V
-40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)I
-7 -1: vmindex
-22 -1: maybeCompileToBytecode
-89 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;
-11 -1: getLauncher
-17 -1: jvm_major_version
-36 -1: ([IIII)Ljava/util/Spliterator$OfInt;
-40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)V
-33 -1: IllegalMonitorStateException.java
-73 -1: ([ILjava/util/function/IntUnaryOperator;)Ljava/util/function/IntConsumer;
-39 -1: (Ljava/lang/String;)Ljava/lang/Package;
-29 -1: java/lang/CharacterDataLatin1
-52 -1: (Ljava/lang/annotation/Annotation;)Ljava/lang/Class;
-49 -1: (Ljava/lang/CharSequence;II)Ljava/nio/CharBuffer;
-53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetDecoder;
-22 -1: Ljava/net/FileNameMap;
-16 -1: isAnonymousClass
-4 -1: item
-7 -1: compute
-12 -1: user.country
-22 -1: malformed context url:
-16 -1: jvm_build_number
-69 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-17 -1: getDirectionality
-4 -1: save
-8 -1: UNMARKED
-58 -1: (Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)V
-12 -1: searchFields
-9 -1: frequency
-23 -1: getLocalizedInputStream
-2 -1:   
-126 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-39 -1: (Ljava/lang/String;Z)Ljava/lang/String;
-7 -1: setZone
-2 -1:  "
-9 -1: checkRef(
-11 -1: loadFromXML
-49 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)V
-68 -1: (IILsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
-2 -1:  (
-54 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
-6 -1: rewind
-13 -1: getAndSetLong
-30 -1: java/lang/invoke/MethodHandles
-11 -1: ListPattern
-97 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/RandomAccess;Ljava/io/Serializable;
-25 -1: (Ljava/io/InputStream;I)V
-9 -1: setMethod
-10 -1: H_REG_NAME
-39 -1: ([Ljava/lang/Object;)Ljava/lang/Object;
-16 -1: AbstractMap.java
-68 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/URLStreamHandler;>;
-58 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
-23 -1: getFileSystemAttributes
-12 -1: toSurrogates
-2 -1: !/
-5 -1: empty
-24 -1: isUnicodeIdentifierStart
-35 -1: sun/nio/cs/StandardCharsets$Classes
-27 -1: [Ljava/security/Permission;
-13 -1: getDefinition
-11 -1: permission=
-42 -1: (ILjava/lang/String;)Ljava/nio/ByteBuffer;
-69 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-3 1: zzz
-17 -1: hasLongPrimitives
-2 -1: !=
-13 -1: getInterfaces
-2 -1: " 
-11 -1: noInflation
-14 -1: aliases_UTF_16
-2 -1: ")
-17 -1: ()Ljava/util/Map;
-55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
-6 -1: charAt
-12 -1: getStringAt0
-10 -1: superClone
-28 -1: Ljava/util/AbstractSet<TK;>;
-40 -1: java/lang/ref/Reference$ReferenceHandler
-22 -1: NaturalOrderComparator
-9 -1: markValue
-9 -1: getRegion
-26 -1: null permissions parameter
-17 -1: Ljava/util/Stack;
-14 -1: codebase=<URL>
-36 -1: (Ljava/util/List;)Ljava/lang/Object;
-17 -1: setJavaLangAccess
-16 -1: hasQueuedThreads
-5 -1: (CC)I
-8 -1: toString
-5 -1: (CC)J
-11 -1: permissions
-10 -1: getHeaders
-27 -1: java/io/BufferedInputStream
-21 -1: unicodelittleunmarked
-51 -1: (Ljava/net/URLClassLoader;Ljava/util/Enumeration;)V
-14 -1: generateMethod
-11 -1: skipForward
-55 -1: java/util/concurrent/ConcurrentHashMap$ForEachEntryTask
-5 -1: (CC)Z
-15 -1: getURLClassPath
-84 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet<Ljava/lang/invoke/MethodType;>;
-23 -1: primitiveParameterCount
-8 -1: security
-14 -1: aliases_UTF_32
-22 -1: ()Ljava/util/Set<TK;>;
-9 -1: listFiles
-15 -1: insertElementAt
-42 -1: Ljava/util/Comparator<Ljava/lang/String;>;
-11 -1: getUserInfo
-46 -1: ([JIILjava/util/function/LongBinaryOperator;)V
-23 -1: (Ljava/util/Iterator;)V
-46 -1: ([Ljava/lang/Object;II)Ljava/util/Spliterator;
-67 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)Ljava/lang/Object;
-14 -1: normalizeMonth
-13 -1: getStackTrace
-51 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet
-8 -1: makeChar
-2 -1: %%
-9 -1: getTarget
-21 -1: packageDefinitionLock
-52 -1: java/util/concurrent/ConcurrentHashMap$ValueIterator
-12 -1: OTHER_NUMBER
-22 -1: java/util/jar/JarEntry
-11 -1: access$1000
-16 -1: NON_SPACING_MARK
-13 -1: last-modified
-68 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Void;>;
-16 -1: Australia/Darwin
-55 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;)V
-29 -1: Ljava/lang/ref/WeakReference;
-19 -1: expungeStaleEntries
-41 -1: Ljava/security/PrivilegedActionException;
-6 -1: update
-23 -1: (Ljava/lang/Object;JB)V
-10 -1: newUpdater
-39 -1: (Ljava/net/URL;)Ljava/util/jar/JarFile;
-25 -1: Ljava/net/ContentHandler;
-21 -1: ARRAY_INT_INDEX_SCALE
-13 -1: hasSurrogates
-27 -1: (Ljava/lang/ThreadGroup;Z)Z
-20 -1: createGCNotification
-21 -1: negative day of week 
-11 -1: getInIfOpen
-22 -1: java/util/RandomAccess
-24 -1:     available locales = 
-21 -1: AccessController.java
-44 -1:  can not access a protected member of class 
-4 -1: LONG
-15 -1: objectOnlyTypes
-75 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)V
-14 -1: getFindClasses
-10 -1: storeFence
-16 -1: asNormalOriginal
-45 -1: (Ljava/lang/String;)Ljava/lang/StringBuilder;
-6 -1: millis
-16 -1: America/St_Johns
-38 -1: ()Ljava/lang/IllegalArgumentException;
-37 -1: DIRECTIONALITY_POP_DIRECTIONAL_FORMAT
-15 -1: implReplaceWith
-29 -1: ([C)Ljava/lang/StringBuilder;
-15 -1: Appendable.java
-41 -1: (Ljava/lang/String;)Ljava/io/InputStream;
-26 -1: Illegal Initial Capacity: 
-9 -1: checkBase
-7 -1: setYear
-15 -1: DISPLAY_VARIANT
-7 -1: getType
-31 -1: Ljava/lang/ref/Reference<+TT;>;
-15 -1: isFieldOrMethod
-35 -1: appendToClassPathForInstrumentation
-16 -1: LocaleNameGetter
-7 -1: compact
-55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
-10 -1: dummyQueue
-3 -1: ROC
-2 -1: ("
-15 -1: checkPermission
-38 -1: java/util/zip/ZipFile$ZipEntryIterator
-8 -1: hexDigit
-8 -1:  pairs: 
-2 -1: ()
-2 -1: )\n
-43 -1: handler for url different from this handler
-15 -1: isAutoDetecting
-37 -1: (Ljava/util/LinkedList$Node<TE;>;)TE;
-11 -1: Unsafe.java
-12 -1: windows-1250
-39 -1: java/util/Collections$CheckedCollection
-12 -1: windows-1251
-15 -1: codePointAtImpl
-12 -1: windows-1252
-12 -1: windows-1253
-12 -1: windows-1254
-58 -1: (Ljava/lang/String;Ljava/lang/Integer;)Ljava/lang/Integer;
-5 -1: deref
-12 -1: windows-1255
-12 -1: windows-1256
-12 -1: windows-1257
-12 -1: windows-1258
-14 -1: FT_CHECKED_REF
-47 -1: (Ljava/util/Hashtable;Ljava/util/Hashtable$1;)V
-37 -1: (J)Lsun/util/calendar/Gregorian$Date;
-19 -1: checkPropertyAccess
-4 -1: file
-17 -1: emptyListIterator
-26 -1: sun/util/calendar/ZoneInfo
-14 -1: file.separator
-4 -1: fill
-62 -1: (Ljava/util/Spliterator$OfLong;Z)Ljava/util/stream/LongStream;
-18 -1: java/util/Iterator
-20 -1: reduceValuesToDouble
-12 -1: LF_CS_LINKER
-26 -1: java/util/Arrays$ArrayList
-45 -1: Ljava/util/concurrent/ConcurrentHashMap$Node;
-6 -1: skipLF
-2 -1: )=
-39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)I
-90 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
-18 -1: parameterModifiers
-31 -1: (Ljava/util/Collection<+TK;>;)Z
-21 -1: proxy can not be null
-22 -1: java/io/FileDescriptor
-6 -1: Loader
-21 -1: numberOfTrailingZeros
-10 -1: addMapping
-39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)Z
-30 -1: java/util/Locale$LanguageRange
-20 -1: getReflectionFactory
-16 -1: shouldMeterInput
-56 -1: ([Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
-23 -1: sun/net/ProgressMonitor
-510 -1: \xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80
-28 -1: java/util/Spliterator$OfLong
-24 -1: SynchronizedNavigableMap
-4 -1: find
-6 -1: unsafe
-31 -1: java/nio/ByteBufferAsIntBufferB
-2 -1: ,\n
-6 -1: [ call
-14 -1: registerFilter
-10 -1: ValuesView
-9 -1: untreeify
-59 -1: ([Ljava/lang/Object;IILjava/util/function/BinaryOperator;)V
-13 -1: getSimpleName
-41 -1: (Ljava/util/Vector;Ljava/util/Vector$1;)V
-31 -1: java/nio/ByteBufferAsIntBufferL
-45 -1: (Ljava/lang/reflect/Field;)Ljava/lang/Object;
-13 -1: getDefaultRef
-18 -1: mapAlternativeName
-30 -1: setDefaultAllowUserInteraction
-13 -1: cannotCastMsg
-4 -1: )=>{
-7 -1: println
-2 -1: , 
-70 -1: (Ljava/nio/Buffer;IILjava/nio/Buffer;II)Ljava/nio/charset/CoderResult;
-32 -1: (ILjava/util/Collection<+TE;>;)Z
-9 -1: interpret
-104 -1: <E:Ljava/lang/Object;>(Ljava/util/NavigableSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/NavigableSet<TE;>;
-7 -1: advance
-86 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/reflect/Field;>;
-11 -1: Stack trace
-6 -1: raise0
-68 -1: ()Ljava/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap;
-32 -1: sun/util/calendar/Gregorian$Date
-33 -1: java/lang/ref/ReferenceQueue$Lock
-19 -1: constructorAccessor
-6 -1: IBM367
-18 -1: CharacterData.java
-8 -1: parseURL
-32 -1: java/io/FilePermissionCollection
-7 -1: ([JI)[J
-9 -1: JIS_X0201
-2 -1: -1
-8 -1: encoding
-63 -1: ([Ljava/util/WeakHashMap$Entry;[Ljava/util/WeakHashMap$Entry;)V
-9 -1: localhost
-66 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal$1;)V
-54 -1: (II[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-67 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-14 -1: containsAllPDs
-23 -1: setAllowUserInteraction
-30 -1: Ljava/security/DomainCombiner;
-26 -1: Ljava/security/Permission;
-30 -1: serializePropertiesToByteArray
-112 -1: (Ljava/util/Iterator<Ljava/nio/charset/Charset;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
-2 -1: ..
-6 -1: LOCEXT
-2 -1: ./
-26 -1: (Ljava/nio/ByteBuffer;II)V
-18 -1: (Ljava/io/File;J)Z
-45 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)V
-17 -1: asCollectorChecks
-7 -1: actions
-5 -1: ([I)I
-20 -1: asChange_otherthread
-20 -1: forInputStreamReader
-69 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject
-5 -1: FINAL
-17 -1: staticPermissions
-44 -1: (Ljava/lang/Object;)Ljava/lang/StringBuffer;
-5 -1: ([I)V
-4 -1: swap
-10 -1: readOffset
-2 -1: /*
-112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-12 -1: isAsciiDigit
-2 -1: /-
-2 -1: /.
-2 -1: //
-5 -1: zones
-37 -1: (ILjava/lang/Object;)Ljava/util/List;
-17 -1: SHUFFLE_THRESHOLD
-32 -1: java/lang/CharacterDataUndefined
-23 -1: sun.reflect.noInflation
-11 -1: Can not set
-36 -1: (Ljava/util/Properties$LineReader;)V
-9 -1: debugName
-78 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode;
-6 -1: (III)J
-58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/lang/String;
-19 -1: BufferedWriter.java
-148 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<TT;>;
-6 -1: printf
-7 -1: signers
-2 -1: 0.
-4 -1: Date
-15 -1: findReplacement
-6 -1: (III)V
-32 -1: java/nio/ReadOnlyBufferException
-92 -1: ([Ljava/lang/String;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-6 -1: (III)Z
-43 -1: (Ljava/lang/ClassValue;Ljava/lang/Object;)V
-32 -1: java/nio/ByteBufferAsLongBufferB
-16 -1: Constructor.java
-10 -1: removeLast
-9 -1: ([CII[B)I
-40 -1: ()Ljava/util/List<Ljava/lang/Class<*>;>;
-2 -1: 1.
-7 -1: VARARGS
-32 -1: java/nio/ByteBufferAsLongBufferL
-18 -1: java/lang/Shutdown
-40 -1:  not supported, using ISO-8859-1 instead
-40 -1: Ljava/util/Collections$EmptyEnumeration;
-146 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/SortedMap<TK;TV;>;
-20 -1: aliases_UTF_32LE_BOM
-23 -1: getEnclosingConstructor
-2 -1: 0X
-11 -1: NO_TIMEZONE
-37 -1: ()Lsun/misc/JavaNioAccess$BufferPool;
-18 -1: printXUsageMessage
-9 -1: isPrivate
-63 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MethodHandle;)V
-17 -1: maxSkipBufferSize
-76 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)V
-40 -1: (Ljava/lang/String;II)Ljava/lang/String;
-17 -1: selectAlternative
-53 -1: [Ljava/util/concurrent/ConcurrentHashMap$CounterCell;
-87 -1: <S:Ljava/lang/Object;>(Ljava/util/function/Supplier<+TS;>;)Ljava/lang/ThreadLocal<TS;>;
-40 -1: Ljava/util/concurrent/ConcurrentHashMap;
-41 -1: (Ljava/lang/Character;)Ljava/lang/String;
-19 -1: getMemberRefInfoAt0
-14 -1: reduceToDouble
-18 -1: SUPPRESSED_CAPTION
-6 -1: CANADA
-64 -1: (IZ[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/String;
-12 -1: UnicodeBlock
-2 -1: 0x
-44 -1: (Ljava/lang/CharSequence;II)Ljava/io/Writer;
-23 -1: getPermissionCollection
-19 -1: threadLocalHashCode
-9 -1: createMap
-25 -1: checkForSpecialAttributes
-12 -1: Mark invalid
-36 -1: java/lang/CharSequence$1CharIterator
-11 -1:  local time
-16 -1: Enumeration.java
-27 -1: (Ljava/util/zip/ZipEntry;)V
-11 -1: MATH_SYMBOL
-8 -1: filename
-24 -1: (Ljava/util/List<*>;II)V
-9 -1: bindCache
-18 -1: java/io/FileFilter
-12 -1: checkInvoker
-18 -1: OSEnvironment.java
-8 -1: EmptyMap
-11 -1: getIterator
-35 -1: java/util/function/IntUnaryOperator
-35 -1: java/util/WeakHashMap$EntryIterator
-90 -1: <E:Ljava/lang/Object;>(Ljava/util/Queue<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Queue<TE;>;
-8 -1: batchFor
-16 -1: isValidCodePoint
-27 -1: ([Lsun/util/calendar/Era;)V
-16 -1: ThreadGroup.java
-33 2: sun/net/www/protocol/file/Handler
-7 -1: isField
-22 -1: sun/misc/OSEnvironment
-38 -1: Ljava/lang/Class<Ljava/lang/Boolean;>;
-12 -1: ADDRESS_SIZE
-8 -1: forDigit
-49 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry;
-13 -1: getCodeSource
-41 -1: ([Ljava/lang/Class<*>;)Ljava/lang/String;
-39 -1: (Ljava/util/function/Predicate<-TE;>;)Z
-13 -1: asFloatBuffer
-34 -1: ()Lsun/reflect/generics/tree/Tree;
-3 -1: ftp
-18 -1: maybeReBoxElements
-82 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[[Ljava/lang/annotation/Annotation;
-48 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
-27 -1: (Ljava/util/NavigableMap;)V
-18 -1: parameterSlotCount
-20 -1: NF_getCallSiteTarget
-16 -1: aliases_US_ASCII
-13 -1: NF_staticBase
-31 -1: sun/reflect/ConstructorAccessor
-26 -1: guessContentTypeFromStream
-10 -1: Deprecated
-35 -1: System initialization has completed
-11 -1: initialized
-7 -1: compare
-15 -1: maxDirectMemory
-19 -1: setLastModifiedTime
-7 -1: (J[BZ)J
-12 -1: readEpochSec
-66 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
-69 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache;
-9 -1: Constants
-11 -1: valueOffset
-62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/Object;>;)V
-33 -1: java/lang/CharacterDataPrivateUse
-21 -1: Exception in thread "
-40 -1: ()Ljava/util/Set<Ljava/lang/Character;>;
-12 -1: Asia/Yerevan
-40 -1: (Ljava/lang/Throwable;)Ljava/lang/Error;
-25 -1: (IS)Ljava/nio/ByteBuffer;
-7 -1: (I[CI)I
-45 -1: java/nio/charset/UnmappableCharacterException
-23 -1: java/util/WeakHashMap$1
-21 -1: setFXLaunchParameters
-1250 -1: ADANDAEAREAFAFGAGATGAIAIAALALBAMARMANANTAOAGOAQATAARARGASASMATAUTAUAUSAWABWAXALAAZAZEBABIHBBBRBBDBGDBEBELBFBFABGBGRBHBHRBIBDIBJBENBLBLMBMBMUBNBRNBOBOLBQBESBRBRABSBHSBTBTNBVBVTBWBWABYBLRBZBLZCACANCCCCKCDCODCFCAFCGCOGCHCHECICIVCKCOKCLCHLCMCMRCNCHNCOCOLCRCRICUCUBCVCPVCWCUWCXCXRCYCYPCZCZEDEDEUDJDJIDKDNKDMDMADODOMDZDZAECECUEEESTEGEGYEHESHERERIESESPETETHFIFINFJFJIFKFLKFMFSMFOFROFRFRAGAGABGBGBRGDGRDGEGEOGFGUFGGGGYGHGHAGIGIBGLGRLGMGMBGNGINGPGLPGQGNQGRGRCGSSGSGTGTMGUGUMGWGNBGYGUYHKHKGHMHMDHNHNDHRHRVHTHTIHUHUNIDIDNIEIRLILISRIMIMNININDIOIOTIQIRQIRIRNISISLITITAJEJEYJMJAMJOJORJPJPNKEKENKGKGZKHKHMKIKIRKMCOMKNKNAKPPRKKRKORKWKWTKYCYMKZKAZLALAOLBLBNLCLCALILIELKLKALRLBRLSLSOLTLTULULUXLVLVALYLBYMAMARMCMCOMDMDAMEMNEMFMAFMGMDGMHMHLMKMKDMLMLIMMMMRMNMNGMOMACMPMNPMQMTQMRMRTMSMSRMTMLTMUMUSMVMDVMWMWIMXMEXMYMYSMZMOZNANAMNCNCLNENERNFNFKNGNGANINICNLNLDNONORNPNPLNRNRUNUNIUNZNZLOMOMNPAPANPEPERPFPYFPGPNGPHPHLPKPAKPLPOLPMSPMPNPCNPRPRIPSPSEPTPRTPWPLWPYPRYQAQATREREUROROURSSRBRURUSRWRWASASAUSBSLBSCSYCSDSDNSESWESGSGPSHSHNSISVNSJSJMSKSVKSLSLESMSMRSNSENSOSOMSRSURSSSSDSTSTPSVSLVSXSXMSYSYRSZSWZTCTCATDTCDTFATFTGTGOTHTHATJTJKTKTKLTLTLSTMTKMTNTUNTOTONTRTURTTTTOTVTUVTWTWNTZTZAUAUKRUGUGAUMUMIUSUSAUYURYUZUZBVAVATVCVCTVEVENVGVGBVIVIRVNVNMVUVUTWFWLFWSWSMYEYEMYTMYTZAZAFZMZMBZWZWE
-60 -1: Ljava/util/Set<Ljava/lang/Class<+Ljava/lang/ClassLoader;>;>;
-24 -1: ()Ljava/security/Policy;
-7 -1: initted
-44 -1: java/util/Collections$UnmodifiableCollection
-12 -1: Pacific/Apia
-23 -1: checkProxyPackageAccess
-7 -1: (I[CI)V
-64 -1: ([Ljava/lang/Object;IILjava/lang/Object;Ljava/util/Comparator;)I
-16 -1: getJavaNioAccess
-7 -1: reverse
-7 -1: nocerts
-16 -1: activeGroupCount
-34 -1: java/util/jar/JarFile$JarFileEntry
-7 -1: loaders
-9 -1: toRadians
-24 -1: java/util/HashMap$KeySet
-37 -1: (Ljava/lang/Class;)Ljava/lang/Object;
-6 -1: getRef
-6 -1: H_DASH
-17 -1: LinkageError.java
-66 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MethodHandle;
-41 -1: (Ljava/nio/ByteBuffer;)Ljava/util/BitSet;
-10 -1: addMinutes
-58 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/Spliterator<TT;>;
-9 -1: parseJars
-13 -1: getUnsignedCS
-28 -1: (Ljava/util/AbstractList;I)V
-22 -1: threadLocalRandomProbe
-19 -1: newDirectByteBuffer
-27 -1: Filter already registered: 
-8 -1: unescape
-31 -1: sun/misc/URLClassPath$JarLoader
-6 -1: TAIWAN
-53 -1: <T:Ljava/lang/Object;>()Ljava/util/ListIterator<TT;>;
-17 -1: REVERSE_THRESHOLD
-31 -1: Java(TM) SE Runtime Environment
-7 -1: SECONDS
-70 -1: (Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-7 -1: BLOCKED
-6 -1: Caches
-63 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)V
-2 -1: : 
-210 -1: (Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;I)V
-153 -1: (JLjava/util/function/BiFunction<Ljava/util/Map$Entry<TK;TV;>;Ljava/util/Map$Entry<TK;TV;>;+Ljava/util/Map$Entry<TK;TV;>;>;)Ljava/util/Map$Entry<TK;TV;>;
-22 -1: ()Ljava/lang/Class<*>;
-28 -1: Ljava/lang/OutOfMemoryError;
-19 -1: writeFileDescriptor
-39 -1: Ljava/util/LinkedHashMap$Entry<TK;TV;>;
-26 -1: (ILjava/util/Collection;)Z
-18 -1: getEncodedInternal
-16 -1: ForEachValueTask
-23 -1: (Ljava/util/List<*>;I)V
-19 -1: SharedArchiveLoader
-20 -1: probeBackupLocations
-24 -1: java/lang/StringCoding$1
-28 -1: lookupContentHandlerClassFor
-36 -1: ()Lsun/misc/Launcher$ExtClassLoader;
-27 -1: reflectionFactoryAccessPerm
-14 -1: ACCESSOR_FORMS
-35 -1: ([JII)Ljava/util/stream/LongStream;
-34 -1: ISO-8859-1 charset not available: 
-8 -1: cscesu-8
-2 -1: ;/
-17 -1: typeToPackageName
-34 -1: (Ljava/net/URL;)Ljava/lang/String;
-5 -1: (IZ)V
-25 -1: Prohibited package name: 
-51 -1: (Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
-108 -1: (JLjava/util/function/ToIntFunction<Ljava/util/Map$Entry<TK;TV;>;>;ILjava/util/function/IntBinaryOperator;)I
-12 -1: soleInstance
-27 -1: (Ljava/io/BufferedReader;)V
-71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetDecoder;
-17 -1: Ljava/lang/Class;
-38 -1: (Ljava/lang/String;)Ljava/lang/Double;
-10 -1: viewAsType
-22 -1: (Ljava/io/DataInput;)I
-22 -1: (Ljava/io/DataInput;)J
-105 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
-16 -1: setJavaNetAccess
-73 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node<TK;TV;>;
-22 -1: (Ljava/io/DataInput;)V
-14 -1: getHostAddress
-37 -1: sun/reflect/annotation/TypeAnnotation
-14 -1: ENCLOSING_MARK
-5 -1: FALSE
-14 -1: preDefineClass
-9 -1: newKeySet
-18 -1: getWaitQueueLength
-32 -1: ()Lsun/misc/URLClassPath$Loader;
-54 -1: (Ljava/nio/CharBuffer;I)Ljava/nio/charset/CoderResult;
-3 -1: SEP
-45 -1: (ITK;TV;Ljava/util/Hashtable$Entry<TK;TV;>;)V
-17 -1: getDeclaredFields
-7 -1: getDate
-10 -1: getClasses
-240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-12 -1: WeakClassKey
-14 -1: LF_GEN_INVOKER
-25 -1: Ljava/lang/StringBuilder;
-2 -1: > 
-9 -1: getJarMap
-4 -1: asin
-37 -1: (Ljava/net/URLStreamHandlerFactory;)V
-30 -1: not a constructor type or name
-4 -1: main
-22 -1: java/io/FilenameFilter
-22 -1: sun.java.launcher.diag
-30 -1: ()Ljava/util/Spliterator<TE;>;
-57 -1: <T::Ljava/lang/Comparable<-TT;>;>(Ljava/util/List<TT;>;)V
-86 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;)TT;
-18 -1: canBeCalledVirtual
-9 -1: Shift_JIS
-24 -1: ()Ljava/util/ArrayDeque;
-32 -1: (Ljava/lang/Class$MethodArray;)V
-22 -1: java/lang/StringCoding
-33 -1: sun/util/locale/LocaleObjectCache
-20 -1: Sorry, deque too big
-38 -1: java/lang/Throwable$WrappedPrintWriter
-25 -1: (Ljava/io/InputStream;J)J
-44 -1: (Ljava/security/Permission;)Ljava/util/List;
-5 -1: thunk
-5 -1: props
-15 -1: getLastModified
-120 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;)V
-146 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/MethodHandleImpl$1;)V
-27 -1: parseExtensionsDependencies
-10 -1: getRawType
-39 -1: (Ljava/nio/charset/CodingErrorAction;)V
-22 -1: ObjectStreamField.java
-6 -1: handle
-11 -1: hasPrevious
-18 -1: instanceof Float: 
-52 -1: (ZLjava/io/OutputStream;Ljava/nio/charset/Charset;)V
-4 -1: make
-13 -1: isIdeographic
-26 -1: java/util/HashMap$EntrySet
-51 -1: (Ljava/util/Hashtable;)[Ljava/util/Hashtable$Entry;
-91 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable<+Ljava/lang/CharSequence;>;)Ljava/lang/String;
-13 -1: makeAllocator
-10 -1: , headless
-20 -1: expungeStaleElements
-58 -1: sun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget
-41 -1: ([Ljava/lang/Object;Ljava/lang/Class$1;)V
-50 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Iterator<TT;>;
-7 -1: TreeBin
-21 -1: Ljava/io/IOException;
-56 -1: (I[Ljava/lang/Class;)[Ljava/lang/invoke/LambdaForm$Name;
-6 -1: LOCFLG
-6 -1: DIRECT
-3 -1: SIG
-37 -1: java/security/NoSuchProviderException
-39 -1: " with illegal data type conversion to 
-16 -1: getCodeSourceURL
-51 -1: java/util/concurrent/ConcurrentHashMap$EntrySetView
-47 -1: (Ljava/util/ArrayList;Ljava/util/ArrayList$1;)V
-6 -1: delete
-38 -1: sun/reflect/UnsafeFieldAccessorFactory
-11 -1: isDestroyed
-140 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)Z
-9 -1: unaligned
-36 -1: ()Lsun/misc/Launcher$AppClassLoader;
-57 -1: (Ljava/lang/String;Ljava/util/Locale;)[Ljava/lang/String;
-37 -1: sun/reflect/annotation/AnnotationType
-49 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/List<TT;>;
-24 -1: (S)Ljava/nio/ByteBuffer;
-6 -1: ([DD)I
-9 -1: setTarget
-29 -1: (IF)Ljava/lang/StringBuilder;
-12 -1: forBasicType
-10 -1: (IIII[BI)V
-8 -1: ([DIID)I
-9 -1: BASE_YEAR
-19 -1: ()Ljava/lang/Error;
-42 -1: (Ljava/util/Map<TE;Ljava/lang/Boolean;>;)V
-6 -1: ([DD)V
-14 -1: Illegal size: 
-8 -1: ([DIID)V
-7 -1: (II[I)I
-17 -1: java_profile_name
-28 -1: java/util/AbstractCollection
-43 -1: (Ljava/net/URL;)[Ljava/security/CodeSource;
-62 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URLStreamHandler;
-33 -1: [Ljava/util/HashMap$Node<TK;TV;>;
-15 -1: (Native Method)
-11 -1: fileNameMap
-26 -1: ()Ljava/util/ListIterator;
-25 -1: java/util/LinkedList$Node
-18 -1: SELECT_ALTERNATIVE
-35 -1: (Ljava/lang/Object;)Ljava/util/Set;
-19 -1: java/io/IOException
-16 -1: : already loaded
-9 -1: image/gif
-6 -1: (TE;)I
-25 -1: (Ljava/util/Properties;)V
-40 -1: (Ljava/lang/String;)Ljava/nio/file/Path;
-19 -1: checkedNavigableMap
-9 -1: checkInt(
-17 -1: getContentTypeFor
-26 -1: ()Ljava/io/FileDescriptor;
-69 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
-6 -1: (TE;)V
-25 -1: WARNING: Default charset 
-14 -1: ZipFile closed
-2 -1: CA
-6 -1: (TE;)Z
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask
-15 -1: FileSystem.java
-75 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-10 -1: FileLoader
-44 -1: (Lsun/util/PreHashedMap;)[Ljava/lang/Object;
-19 -1: availableProcessors
-2 -1: CN
-36 -1: ([JII)Ljava/util/Spliterator$OfLong;
-11 -1: access$1100
-18 -1: getFieldAtIfLoaded
-30 -1: PrivilegedActionException.java
-6 -1: EUC-JP
-20 -1: (F)Ljava/lang/Float;
-22 -1: unable to instantiate 
-31 -1: java/lang/reflect/ReflectAccess
-23 -1: (Ljava/lang/Object;JC)V
-3 -1: get
-59 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/Comparator<-TT;>;)V
-2 -1: DE
-13 -1: GMT_ID_LENGTH
-7 -1: execute
-12 -1: MethodHandle
-18 -1: AllPermission.java
-54 -1: (Ljava/util/Locale;)Lsun/util/locale/LocaleExtensions;
-23 -1: MapReduceKeysToLongTask
-12 -1: varargsArray
-23 -1: java/util/jar/JarFile$1
-23 -1: java/util/jar/JarFile$2
-23 -1: java/util/jar/JarFile$3
-12 -1: getAndUpdate
-13 -1: reserveMemory
-17 -1: expungeStaleEntry
-6 -1: EUC-KR
-120 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<Ljava/lang/Object;>;Ljava/util/Map$Entry<TK;TV;>;
-69 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)Ljava/util/regex/Matcher;
-26 -1: ()Ljava/util/NavigableMap;
-7 -1: L_PCHAR
-23 -1: (Ljava/lang/String$1;)V
-4 -1: KEYS
-37 -1: (Ljava/util/List;Ljava/lang/Object;)I
-31 -1: Ljava/lang/ArithmeticException;
-15 -1: [Ljava/net/URL;
-37 -1: (Ljava/util/List;Ljava/lang/Object;)V
-18 -1: MAX_HIGH_SURROGATE
-6 -1: (JCZ)V
-4 -1: mark
-17 -1: setMethodAccessor
-21 -1: java/io/ExpiringCache
-21 -1: PrivilegedAction.java
-21 -1: MappedByteBuffer.java
-2 -1: FR
-10 -1: copyMemory
-8 -1: L_SERVER
-13 -1: assertionLock
-12 -1: searchValues
-46 -1: (Ljava/util/Collection<*>;Ljava/lang/Object;)I
-21 -1: ProtectionDomainCache
-32 -1: USE_PREDEFINED_INTERPRET_METHODS
-2 -1: GB
-16 -1: getFinalRefCount
-23 -1: Ljava/lang/ClassLoader;
-4 -1: mask
-94 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-4 -1: bind
-41 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Object;
-9 -1: COUNT_GWT
-16 -1: DASH_PUNCTUATION
-24 -1: UNICODE_LOCALE_EXTENSION
-15 -1: checkInvariants
-10 -1: stringSize
-12 -1: deepHashCode
-30 -1: java/security/cert/Certificate
-19 -1: America/Los_Angeles
-19 -1: unmappableForLength
-6 -1: UTF-16
-10 -1: methodType
-21 -1: sun/misc/URLClassPath
-19 -1: META-INF/INDEX.LIST
-10 -1: jniVersion
-6 -1: IBM437
-29 -1: sun/reflect/FieldAccessorImpl
-21 -1: ()Ljava/lang/Package;
-32 -1: java/security/SecurityPermission
-57 -1: (Lsun/util/calendar/Era;)Lsun/util/calendar/CalendarDate;
-34 -1: [Ljava/util/concurrent/locks/Lock;
-11 -1: replacement
-20 -1: ()Ljava/lang/String;
-6 -1: resize
-12 -1: UTF_32BE_BOM
-26 -1: (Ljava/util/jar/JarFile;)V
-24 -1: DEFAULT_INITIAL_CAPACITY
-87 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-74 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
-18 -1: parameterSlotDepth
-26 -1: (Ljava/util/jar/JarFile;)Z
-18 -1: makePlatformString
-24 -1: doPrivilegedWithCombiner
-48 -1: (Ljava/lang/String;)Lsun/util/calendar/ZoneInfo;
-27 -1: ()Ljava/lang/ref/Reference;
-40 -1: java/util/ArrayList$ArrayListSpliterator
-67 -1: ([Ljava/lang/Object;IILjava/util/Comparator;[Ljava/lang/Object;II)V
-2 -1: ID
-19 -1: stringPropertyNames
-28 -1: (Ljava/util/Collections$1;)V
-12 -1: STATE_YELLOW
-12 -1: isNormalized
-10 -1: fromIndex(
-16 -1: getFloatVolatile
-37 -1: Lsun/util/calendar/BaseCalendar$Date;
-10 -1: properties
-17 -1: peakFinalRefCount
-102 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-68 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-2 -1: IT
-9 -1: ([BI[BI)V
-51 -1: scl           permissions SecureClassLoader assigns
-36 -1: (Ljava/util/Set;Ljava/lang/Object;)V
-11 -1: ([SII[SII)V
-21 -1: sun.io.useCanonCaches
-18 -1: Illegal capacity: 
-22 -1: (Ljava/lang/Integer;)I
-83 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set<[Ljava/lang/Object;>;)V
-65 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;II)V
-17 -1: java/util/Objects
-48 -1: (ILjava/util/List;)Ljava/lang/invoke/LambdaForm;
-31 -1: java/util/Properties$XmlSupport
-10 -1: L_LOWALPHA
-13 -1: long overflow
-25 -1: NullPointerException.java
-32 -1: (I)Ljava/lang/StackTraceElement;
-34 -1: ()[Ljava/lang/reflect/Constructor;
-2 -1: JP
-3 -1: SST
-12 -1: ShortCountry
-48 -1: (Ljava/util/stream/Collector;)Ljava/lang/Object;
-29 -1: Lsun/reflect/CallerSensitive;
-10 -1: addElement
-12 -1: lastReturned
-6 -1: putInt
-34 -1: sun.misc.JarIndex.metaInfFilenames
-13 -1: getBaseLocale
-20 -1: StringTokenizer.java
-8 -1: entrySet
-11 -1: getTypeName
-17 -1: America/Sao_Paulo
-5 -1: \t... 
-35 -1: (Lsun/util/calendar/CalendarDate;)I
-28 -1: java/lang/StackOverflowError
-35 -1: (Lsun/util/calendar/CalendarDate;)J
-10 -1: logicalAnd
-18 -1: csISOLatinCyrillic
-43 -1: (Ljava/lang/String;II)Ljava/nio/CharBuffer;
-73 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodType;
-14 -1: aliases_MS1250
-14 -1: aliases_MS1251
-17 -1: getImplMethodKind
-17 -1: getLastAccessTime
-14 -1: aliases_MS1252
-14 -1: aliases_MS1253
-35 -1: (Lsun/util/calendar/CalendarDate;)V
-2 -1: KR
-14 -1: aliases_MS1254
-14 -1: getGenericInfo
-8 -1: utf_32be
-14 -1: aliases_MS1257
-35 -1: (Lsun/util/calendar/CalendarDate;)Z
-13 -1: StringEncoder
-7 -1: LDT2037
-7 -1: generic
-2 -1: L9
-45 -1: ([DLjava/util/function/IntToDoubleFunction;)V
-17 -1: isOtherAlphabetic
-9 -1: implWrite
-24 -1: PC-Multilingual-850+euro
-12 -1: valueMatches
-78 -1: (Ljava/lang/String;Lsun/util/locale/ParseStatus;)Lsun/util/locale/LanguageTag;
-3 -1: gmt
-19 -1: (Ljava/io/Reader;)V
-25 -1: (JJ)Ljava/nio/ByteBuffer;
-7 -1: val$url
-26 -1: (Ljava/nio/ByteBuffer;IJ)V
-10 -1: isImplicit
-19 -1: getDeclaredClasses0
-4 -1: (I)B
-4 -1: (I)C
-4 -1: (I)D
-9 -1: byteValue
-4 -1: (I)F
-5 -1: ([J)I
-6 -1: isLive
-5 -1: sleep
-4 -1: (I)I
-4 -1: (I)J
-6 -1: outBuf
-77 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Set<TE;>;
-4 -1: (I)S
-5 -1: ([J)V
-4 -1: (I)V
-30 -1: (I[C)Ljava/lang/StringBuilder;
-14 -1: intBitsToFloat
-4 -1: (I)Z
-15 -1: MethodType.java
-14 -1: resolveSibling
-9 -1: Enum.java
-111 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-14 -1: IS_CONSTRUCTOR
-4 -1: bits
-34 -1: java/security/PermissionCollection
-9 -1: autoFlush
-21 -1: java/util/Collections
-12 -1: bindReceiver
-20 -1: DMH.invokeStaticInit
-11 -1: charsetName
-14 -1: x-utf-32be-bom
-5 -1: cause
-7 -1: handle0
-43 -1: ([I[C[Ljava/lang/invoke/LambdaForm$Name;I)Z
-30 -1: getDefaultAllowUserInteraction
-18 -1: ConcurrentMap.java
-35 -1: (Ljava/lang/String;Z)Ljava/net/URL;
-33 -1: Ljava/nio/charset/CharsetDecoder;
-36 -1: java/lang/invoke/MethodHandleStatics
-34 -1: java/util/concurrent/ConcurrentMap
-16 -1: collectArguments
-22 -1: packageAssertionStatus
-79 -1: (JLjava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)J
-39 -1: Cannot reflectively create enum objects
-62 -1: attempt to add a Permission to a readonly PermissionCollection
-22 -1: FieldAccessorImpl.java
-9 -1: ByteCache
-4 -1: TRUE
-85 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Character;>;
-17 -1: java.library.path
-7 -1: encoder
-21 -1:     default locale = 
-11 -1: secondOfDay
-37 -1: (Lsun/util/calendar/ZoneInfoFile$1;)V
-35 -1: sun/reflect/UnsafeFieldAccessorImpl
-24 -1: (Ljava/lang/Object;JJJ)V
-16 -1: countStackFrames
-24 -1: (Ljava/lang/Object;JJJ)Z
-17 -1: nonfairTryAcquire
-20 -1: ArrayListSpliterator
-5 -1: /DMH=
-68 -1: (Ljava/lang/CharSequence;Ljava/lang/CharSequence;)Ljava/lang/String;
-2 -1: PI
-8 -1: cspcp852
-112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/Locale;
-8 -1: cspcp855
-58 -1: (Ljava/lang/Object;JLjava/lang/Object;Ljava/lang/Object;)Z
-33 -1: sun/misc/PerfCounter$CoreCounters
-6 -1: CESU_8
-7 -1: vmslots
-4 -1: Init
-7 -1: handler
-11 -1: getProperty
-10 -1: isVolatile
-8 -1: ([J[IJ)I
-25 -1: ()Ljava/lang/ClassLoader;
-8 -1: asChange
-81 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
-12 -1: naturalOrder
-8 -1: getState
-40 -1: (Ljava/lang/Object;I)[Ljava/lang/String;
-36 -1: java/security/AccessControlException
-10 -1: linkBefore
-48 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;Z)V
-26 -1: (Ljava/util/WeakHashMap;)V
-23 -1: bad method type alias: 
-7 -1: putChar
-18 -1: basicTypeSignature
-33 -1: sun/misc/InvalidJarIndexException
-13 -1: getPrivateuse
-14 -1: isConstantZero
-24 -1: java/io/FilePermission$1
-9 -1: Long.java
-19 -1: getLocaleExtensions
-10 -1: discovered
-17 -1: Invalid file path
-12 -1: MAX_MH_ARITY
-20 -1: observesDaylightTime
-31 -1: Ljava/lang/invoke/MethodHandle;
-6 -1: , end 
-24 -1: java/io/FileDescriptor$1
-12 -1: loadLibrary.
-11 -1: Method.java
-12 -1: loadLibrary0
-23 -1: java/util/stream/Stream
-37 -1: sun.lang.ClassLoader.allowArraySyntax
-8 -1: appClass
-15 -1: FileReader.java
-5 -1: (IF)I
-29 -1: [Ljava/lang/ClassValue$Entry;
-12 -1: (principals 
-30 -1: jar           jar verification
-22 -1: ARRAY_CHAR_BASE_OFFSET
-18 -1: newDirectoryStream
-4 -1: atan
-5 -1: (IF)V
-24 -1: (Ljava/lang/Character;)I
-2 -1: TH
-10 -1: startsWith
-9 -1: baseCount
-13 -1: canonicalize0
-47 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class<*>;)V
-22 -1: Ljava/io/OutputStream;
-2 -1: TW
-10 -1: H_RESERVED
-19 -1: URLClassLoader.java
-16 -1: isAccessibleFrom
-59 -1: Ljava/util/Hashtable<Ljava/lang/Object;Ljava/lang/Object;>;
-33 -1: java/lang/invoke/ConstantCallSite
-14 -1: Ljava/net/URL;
-12 -1: deleteOnExit
-20 -1: MAX_SKIP_BUFFER_SIZE
-30 -1: [Ljava/lang/ref/WeakReference;
-15 -1: contentPathProp
-9 -1: initCause
-53 -1: (Ljava/util/Queue;Ljava/lang/Class;)Ljava/util/Queue;
-20 -1: java/util/TimeZone$1
-2 -1: UK
-86 -1: (BLjava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-51 -1: (II[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-18 -1: Lsun/misc/Cleaner;
-31 -1: RuntimeInvisibleTypeAnnotations
-2 -1: US
-7 -1: makeInt
-40 -1: sun/reflect/annotation/AnnotationSupport
-28 -1: sun/reflect/misc/ReflectUtil
-8 -1: utf_32le
-40 -1: (Ljava/lang/Object;JLjava/lang/Object;)V
-24 -1: java/nio/file/WatchEvent
-66 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
-91 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
-114 -1: (Ljava/lang/ThreadLocal;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-20 -1: internalWriteEntries
-79 -1: <T:Ljava/lang/Object;>(TT;Ljava/util/function/Supplier<Ljava/lang/String;>;)TT;
-14 -1: bitIndex < 0: 
-88 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-6 -1: , len 
-28 -1: java/io/BufferedOutputStream
-11 -1: System.java
-11 -1: csISOLatin1
-11 -1: csISOLatin2
-28 -1: Ljava/io/OutputStreamWriter;
-27 -1: IllegalAccessException.java
-11 -1: csISOLatin4
-14 -1: isDaylightTime
-11 -1: csISOLatin5
-21 -1: getYearLengthInMonths
-13 -1: canonicalizes
-93 -1: "'s signer information does not match signer information of other classes in the same package
-32 -1: ()Lsun/management/GcInfoBuilder;
-37 -1: (IILjava/nio/charset/CoderResult$1;)V
-10 -1: stateNames
-46 -1: (Ljava/lang/String;)Ljava/nio/charset/Charset;
-21 -1: acquireMethodAccessor
-2 -1: X-
-32 -1: java/security/ProtectionDomain$1
-5 -1: atan2
-32 -1: java/security/ProtectionDomain$2
-32 -1: java/security/ProtectionDomain$3
-41 -1: malformed input: partial character at end
-18 -1: dropParameterTypes
-44 -1: (Ljava/lang/String;)Ljava/lang/StringBuffer;
-18 -1: CalendarUtils.java
-5 -1: month
-84 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/ClassLoader;>;
-33 -1: sun/misc/JavaNioAccess$BufferPool
-18 -1: SearchMappingsTask
-38 -1: DelegatingConstructorAccessorImpl.java
-80 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
-8 -1: instance
-54 -1: Parameter annotations don't match number of parameters
-14 -1: createConstant
-35 -1: java/lang/invoke/MemberName$Factory
-4 -1: scrt
-34 -1: Ljava/lang/InstantiationException;
-20 -1: allowUserInteraction
-15 -1: java/util/Deque
-16 -1: forEachRemaining
-35 -1: (J)Lsun/util/calendar/CalendarDate;
-13 -1: no such field
-25 -1: java/nio/file/FileSystems
-16 -1: expectedModCount
-44 -1: (Ljava/io/File;ILjava/nio/charset/Charset;)V
-12 -1: createString
-15 -1: useDaylightTime
-31 -1: java/util/Properties$LineReader
-111 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class<*>;I[Ljava/lang/invoke/MemberName;)I
-16 -1: java/util/Locale
-26 -1: URLClassPath.getResource("
-58 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)V
-10 -1: appendTail
-7 -1: cleaner
-78 -1: (Lsun/nio/cs/FastCharsetProvider;Ljava/lang/String;)Ljava/nio/charset/Charset;
-18 -1: convertOldISOCodes
-4 -1: year
-38 -1: java/lang/ReflectiveOperationException
-28 -1: (Ljava/lang/StringBuffer;B)V
-27 -1: (D)Ljava/lang/StringBuffer;
-17 -1: emptyNavigableSet
-7 -1: indices
-10 -1:  is sealed
-21 -1: SPECIFICATION_VERSION
-3 -1: TE;
-8 -1: addMonth
-24 -1: java/util/HashMap$Values
-17 -1: SEARCH_ALL_SUPERS
-18 -1: uncaught exception
-14 -1: declaredFields
-2 -1: [B
-2 -1: [C
-8 -1: ABSTRACT
-2 -1: [D
-2 -1: [F
-2 -1: [I
-2 -1: [J
-5 -1: false
-36 -1: (Ljava/net/URL;Ljava/lang/String;J)V
-12 -1: equalContext
-11 -1: VOID_RESULT
-2 -1: [S
-24 -1: (JLjava/lang/Object;JJ)V
-36 -1: Ljava/security/PermissionCollection;
-2 -1: [Z
-17 -1: floatToRawIntBits
-2 -1: []
-21 -1: ()[Ljava/lang/Thread;
-20 -1: [Ljava/lang/Integer;
-42 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Z)V
-19 -1: checkPrintJobAccess
-40 -1: (Ljava/lang/Object;)Ljava/lang/Class<*>;
-31 -1: (Lsun/reflect/FieldAccessor;Z)V
-10 -1: reallyPoll
-52 -1: (Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
-100 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-19 -1: CheckedNavigableMap
-48 -1: (Ljava/lang/String;)Ljava/lang/RuntimeException;
-35 -1: java/util/Hashtable$ValueCollection
-89 -1: (JLjava/util/function/ToDoubleFunction<-TK;>;DLjava/util/function/DoubleBinaryOperator;)D
-10 -1: Stack.java
-57 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;I)V
-12 -1: getTimeOfDay
-12 -1: reduceValues
-22 -1: warnUnsupportedCharset
-34 -1: (Ljava/lang/ref/Reference<+TS;>;)Z
-31 -1: EEE, dd MMM yyyy HH:mm:ss 'GMT'
-19 -1: setCachedLambdaForm
-21 -1: (I)Ljava/lang/Object;
-85 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;Ljava/util/Locale$1;)V
-36 -1: java/security/AccessControlContext$1
-27 -1: Lsun/net/www/MessageHeader;
-23 -1: ()[Ljava/lang/Class<*>;
-14 -1: refKindIsValid
-41 -1: sun/reflect/NativeConstructorAccessorImpl
-6 -1: binary
-23 -1: ()Ljava/nio/CharBuffer;
-8 -1: getSpace
-45 -1: bootstrap method failed to produce a CallSite
-15 -1: getISO3Language
-17 -1: TRANSITION_NSHIFT
-163 -1: ([Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-7 -1: os.name
-38 -1: java/util/function/IntToDoubleFunction
-8 -1: checkInt
-21 -1: java/lang/VerifyError
-42 -1: sunpkcs11     SunPKCS11 provider debugging
-19 -1: URI is not absolute
-23 -1: java/io/DataInputStream
-53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetEncoder;
-2 -1: _#
-41 -1: (Ljava/io/FilenameFilter;)[Ljava/io/File;
-26 -1: Ljava/util/jar/Attributes;
-7 -1: collect
-17 -1: Lsun/misc/Unsafe;
-97 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Enumeration<TT;>;)Ljava/util/ArrayList<TT;>;
-28 -1: (II)Ljava/lang/StringBuffer;
-54 -1: (Ljava/lang/reflect/Constructor<*>;)Ljava/lang/String;
-28 -1: ()Ljava/util/ResourceBundle;
-48 -1: java/util/ArraysParallelSortHelpers$FJInt$Sorter
-9 -1: no access
-57 -1: <S:Ljava/lang/Object;>Ljava/lang/ref/ReferenceQueue<TS;>;
-7 -1: getPerf
-11 -1: getClassAt0
-11 -1: rtypeOffset
-20 -1: thread can't be null
-12 -1: addArguments
-12 -1: utf_32le_bom
-21 -1: allowThreadSuspension
-25 -1: defaultExpectedLineLength
-11 -1: removeFirst
-13 -1: reduceEntries
-20 -1: Read-ahead limit < 0
-57 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<-TT;>;[TT;)Z
-39 -1: ()Ljava/lang/invoke/MemberName$Factory;
-13 -1: ZipCoder.java
-16 -1: java/lang/Thread
-27 -1: java/lang/NoSuchMethodError
-66 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;)[Ljava/security/CodeSource;
-22 -1: java/lang/StringBuffer
-3 -1: TK;
-34 -1: (I)Ljava/lang/invoke/MethodHandle;
-30 -1: (Ljava/lang/reflect/Method;Z)V
-13 -1: file.encoding
-14 -1: removeTreeNode
-27 -1: sun/misc/JavaSecurityAccess
-58 -1: ([Ljava/lang/Object;ILjava/lang/Class;)[Ljava/lang/Object;
-19 -1: equalLimitedContext
-22 -1: appendVmSynonymMessage
-10 -1: applyAsInt
-23 -1: privateGetPublicMethods
-11 -1: dumpThreads
-25 -1: RuntimeVisibleAnnotations
-37 -1: (IF)Ljava/lang/AbstractStringBuilder;
-18 -1: getBooleanVolatile
-27 -1: (Ljava/util/zip/ZipFile;J)V
-25 -1: INITIAL_QUOTE_PUNCTUATION
-51 -1: (Ljava/util/Map;)[Ljava/lang/annotation/Annotation;
-54 -1: (ILjava/lang/Object;)Ljava/lang/AbstractStringBuilder;
-20 -1: reflectionDataOffset
-2 1: aa
-51 -1: (Ljava/util/jar/Attributes$Name;)Ljava/lang/String;
-13 -1: transferLinks
-18 -1: java/util/Vector$1
-10 -1: ensureOpen
-22 -1: getDeclaredConstructor
-2 -1: am
-19 -1: NF_allocateInstance
-66 -1: (Ljava/util/Spliterator$OfDouble;Z)Ljava/util/stream/DoubleStream;
-6 -1: ([SS)I
-17 -1: newReflectionData
-19 -1: subclassAuditsQueue
-11 -1: access$1200
-16 -1: ValueSpliterator
-18 -1: preparedLambdaForm
-38 -1: (Ljava/net/URL;)Ljava/net/InetAddress;
-14 -1: getMaxPriority
-32 -1: ()[Ljava/lang/StackTraceElement;
-67 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask
-62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/String;>;)V
-6 -1: EXTHDR
-14 -1: java/util/Date
-2 -1: az
-6 -1: ([SS)V
-15 -1: arrayBaseOffset
-9 -1: isTrusted
-23 -1: (Ljava/lang/Object;JD)V
-2 -1: bb
-10 -1: ([BII[BI)V
-7 -1: toLower
-14 -1: invoke_LLLLL_L
-7 -1: jarfile
-42 -1: (Ljava/lang/String;)Lsun/misc/PerfCounter;
-28 -1: java/lang/ref/Reference$Lock
-16 -1: java/util/BitSet
-22 -1: jarfile parsing error!
-18 -1: jdk_update_version
-14 -1: invoke_LLLLL_V
-20 -1: java/util/LinkedList
-22 -1: erasedInvokerWithDrops
-25 -1: timeout value is negative
-21 -1: getCalendarProperties
-25 -1: not a method descriptor: 
-2 -1: cb
-31 -1: (Lsun/misc/JavaUtilJarAccess;)V
-2 -1: cd
-43 -1: Lsun/util/PreHashedMap<Ljava/lang/String;>;
-12 -1: getEntrySize
-2 -1: ce
-24 -1: guessContentTypeFromName
-2 -1: ch
-14 -1: JulianCalendar
-22 -1: [Ljava/lang/Cloneable;
-122 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-34 -1: Lsun/util/locale/BaseLocale$Cache;
-14 -1: LinkedEntrySet
-72 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/io/Serializable;
-39 -1: ()Ljava/io/ObjectOutputStream$PutField;
-2 -1: cs
-8 -1: indexFor
-25 -1: (Ljava/util/List<+TE;>;)V
-7 -1: subpath
-11 -1: invokeExact
-14 -1: setFileNameMap
-22 -1: LangReflectAccess.java
-8 -1: referent
-34 -1: java/util/MissingResourceException
-77 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;Ljava/net/URL;)Ljava/lang/Package;
-11 -1: ([FII[FII)V
-17 -1: getParameterCount
-18 -1: isMemberAccessible
-10 -1: getExtDirs
-69 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;Ljava/util/List<+TT;>;)V
-9 -1: getNextPC
-13 -1: setProperties
-2 -1: de
-16 -1: generateCertPath
-6 -1: decode
-16 -1: getDefaultParent
-50 -1: (Ljava/net/URL;[Ljava/security/cert/Certificate;)V
-24 -1: Certificate factory for 
-35 -1: ()Ljava/lang/reflect/AnnotatedType;
-2 -1: ee
-12 -1: asLongBuffer
-7 -1: PRIVATE
-16 -1: aliases_UTF_32BE
-2 -1: en
-2 -1: eq
-7 -1: indexOf
-136 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<+Ljava/lang/Throwable;>;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-24 -1: (Ljava/lang/Class<*>;I)V
-72 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/IllegalAccessException;
-35 -1: java/util/jar/JavaUtilJarAccessImpl
-24 -1: (Ljava/lang/Class<*>;I)Z
-2 -1: ex
-24 -1: getProtectionDomainCache
-101 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;JLjava/security/AccessControlContext;)V
-3 -1: hit
-8 -1: UTF_16BE
-2 -1: fd
-16 -1: EmptyEnumeration
-4 -1: attr
-16 -1: fromIndex < -1: 
-7 -1: getIntB
-22 -1: java/io/FilePermission
-2 -1: fr
-2 -1: fs
-7 -1: lazySet
-7 -1: getIntL
-37 -1: configfile    JAAS ConfigFile loading
-24 -1: sun/nio/cs/StreamEncoder
-40 -1: (Ljava/time/ZoneId;)Ljava/util/TimeZone;
-132 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiConsumer;)V
-2 -1: gc
-18 -1: Ljava/lang/Thread;
-10 -1: cacheArray
-48 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile;
-61 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)V
-8 -1: readByte
-7 -1: ([S[S)Z
-24 -1: findBootstrapClassOrNull
-2 -1: hb
-7 -1: REPLACE
-45 -1: ()Ljava/util/Enumeration<Ljava/lang/String;>;
-10 -1: isOverflow
-2 -1: he
-13 -1: getCachedJan1
-12 -1: getClassPath
-8 -1: leapYear
-31 -1: java/lang/invoke/MethodTypeForm
-10 -1: ANNOTATION
-20 -1: getGregorianCalendar
-11 -1: ISO_8859_13
-11 -1: ISO_8859_15
-6 -1: invoke
-2 -1: ht
-7 -1: ListItr
-15 -1: synchronizedMap
-7 -1: cleanup
-94 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Lsun/reflect/annotation/AnnotationType;
-3 -1: TT;
-69 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/Gregorian$Date;
-81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;)Z
-20 -1:     Min. Heap Size: 
-33 -1: (IZ)Ljava/lang/invoke/MethodType;
-2 -1: id
-7 -1: ([DI)[D
-37 -1: (Ljava/lang/reflect/Constructor<*>;)I
-42 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;II)V
-13 -1: addSuppressed
-28 -1: internalMemberNameEnsureInit
-2 -1: in
-17 -1: getCompressedSize
-34 -1: sun/misc/Launcher$AppClassLoader$1
-88 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;)Ljava/security/AccessControlContext;
-37 -1: (Ljava/lang/reflect/Constructor<*>;)V
-2 -1: is
-2 -1: it
-6 -1: ENDOFF
-4 -1: void
-2 -1: iw
-14 -1: emptySortedSet
-2 -1: ix
-17 -1: unicode-1-1-utf-8
-64 -1: (Ljava/lang/Class;Ljava/util/List;)Ljava/lang/invoke/MethodType;
-46 -1: (Lsun/misc/URLClassPath$Loader;)Ljava/net/URL;
-2 -1: ja
-13 -1: synchronized 
-76 -1: ([DLjava/util/function/IntToDoubleFunction;)Ljava/util/function/IntConsumer;
-11 -1: wrapperType
-51 -1: <T:Ljava/lang/Object;>()Ljava/util/Comparator<TT;>;
-106 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/Object;
-17 -1: removeAllElements
-2 -1: ji
-24 -1: java/util/Vector$ListItr
-14 -1: getNestedTypes
-6 -1: L_MARK
-27 -1: Source does not fit in dest
-2 -1: l1
-2 -1: jp
-2 -1: l2
-4 -1: (J)B
-57 -1: (Ljava/lang/String;Ljava/util/Locale;I)Ljava/lang/String;
-4 -1: (J)C
-27 -1: ForEachTransformedValueTask
-2 -1: l4
-26 -1: java/util/Hashtable$KeySet
-4 -1: (J)D
-2 -1: l5
-39 -1: java/security/BasicPermissionCollection
-4 -1: (J)F
-2 -1: jv
-29 -1: MapReduceMappingsToDoubleTask
-18 -1: copyFromShortArray
-2 -1: l9
-3 -1: TV;
-4 -1: (J)I
-4 -1: (J)J
-23 -1: Lsun/util/calendar/Era;
-8 -1: x-EUC-TW
-15 -1: checkSetFactory
-7 -1: Special
-4 -1: (J)S
-4 -1: (J)V
-7 -1: invoke_
-25 -1: (IC)Ljava/nio/ByteBuffer;
-68 -1: (JLjava/util/concurrent/TimeUnit;)Ljava/nio/file/attribute/FileTime;
-36 -1: ()Ljava/net/URLStreamHandlerFactory;
-4 -1: (J)Z
-181 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;)Z
-9 -1: getOffset
-46 -1: (ILjava/lang/String;)Ljava/lang/StringBuilder;
-7 -1: element
-15 -1: createByteArray
-17 -1: uncaughtException
-2 -1: ko
-29 -1: java/nio/file/DirectoryStream
-15 -1: getISOCountries
-246 -1: <NoSuchMemberException:Ljava/lang/ReflectiveOperationException;>(BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;Ljava/lang/Class<TNoSuchMemberException;>;)Ljava/lang/invoke/MemberName;^Ljava/lang/IllegalAccessException;^TNoSuchMemberException;
-7 -1: invoker
-17 -1: langReflectAccess
-10 -1: bindSingle
-23 -1: java/lang/reflect/Proxy
-2 -1: lb
-2 -1: lc
-29 -1: CREATE_CLASSLOADER_PERMISSION
-5 -1: isSet
-18 -1: ([Ljava/io/File;)V
-15 -1: urlNoFragString
-21 -1: DirectByteBuffer.java
-15 -1: java.class.path
-15 -1: createDirectory
-4 -1:  GMT
-37 -1: sun/reflect/annotation/ExceptionProxy
-28 -1: (Ljava/util/Map<+TK;+TV;>;)V
-17 -1: getContentHandler
-26 -1: GenericDeclRepository.java
-56 -1: (Ljava/lang/String;)Ljava/lang/IllegalArgumentException;
-15 -1: getJavaIOAccess
-39 -1: java/util/Collections$EmptyListIterator
-34 -1: java/lang/ConditionalSpecialCasing
-82 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMBean;
-58 -1: (Ljava/util/function/ToIntFunction;)Ljava/util/Comparator;
-21 -1: ()Lsun/misc/Launcher;
-2 -1: lt
-92 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIILjava/util/concurrent/ConcurrentHashMap;)V
-8 -1: disjoint
-62 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/net/URLStreamHandler;)V
-24 -1: ([Ljava/lang/Object;)TT;
-4 -1: lmap
-8 -1: SATURDAY
-12 -1: toStringUTF8
-91 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BinaryOperator;)Ljava/lang/Object;
-46 -1: pkcs11        PKCS11 session manager debugging
-27 -1: (Z)Ljava/lang/StringBuffer;
-7 -1: forEach
-17 -1: (Ljava/io/File;)I
-17 -1: (Ljava/io/File;)J
-5 -1: RESET
-6 -1: isFile
-14 -1: Exception.java
-8 -1: isPublic
-27 -1: computeInitialPreparedForms
-50 -1: (BZLjava/lang/Class;)Ljava/lang/invoke/LambdaForm;
-19 -1: getAvailableLocales
-17 -1: (Ljava/io/File;)V
-28 -1: ()Ljava/nio/charset/Charset;
-10 -1: appendNull
-17 -1: (Ljava/io/File;)Z
-23 -1: java/lang/InternalError
-2 -1: ne
-6 -1: radix 
-8 -1: checksum
-66 -1: (Lsun/net/www/MessageHeader;Ljava/lang/String;Ljava/lang/Object;)V
-45 -1: (Ljava/io/FilenameFilter;)[Ljava/lang/String;
-8 -1: checkJar
-28 -1:     default format locale = 
-13 -1: normalizeTime
-26 -1: java/util/AbstractList$Itr
-30 -1: java/util/function/IntFunction
-7 -1: TIS-620
-12 -1: reverseBytes
-2 -1: of
-26 -1: java/lang/ClassFormatError
-109 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-10 -1: delimiters
-20 -1: indexOfSupplementary
-16 -1: aliases_UTF_32LE
-134 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/Map<TK;TV;>;
-17 -1: [Ljava/lang/Long;
-2 -1: or
-12 -1: getClassName
-31 -1: (Ljava/nio/charset/Charset;FF)V
-6 -1: ([FF)I
-39 -1: (Ljava/util/Locale;)[Ljava/lang/String;
-33 -1: java/util/WeakHashMap$KeyIterator
-8 -1: UTF_16LE
-12 -1: isISOControl
-75 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;Z)Ljava/nio/charset/CoderResult;
-7 -1: ([I[I)Z
-28 -1: Self-causation not permitted
-6 -1: ([FF)V
-14 -1: defaultCharset
-12 -1: isJavaLetter
-2 -1: pm
-39 -1: cannot reflectively invoke MethodHandle
-20 -1: getSystemClassLoader
-42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)I
-56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/Object;
-42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)V
-12 -1: ZipFile.java
-43 -1: (Ljava/util/zip/ZipFile;)Ljava/lang/String;
-22 -1: Ljava/net/InetAddress;
-15 -1: getCharVolatile
-32 -1: ()[Ljava/lang/reflect/Parameter;
-13 -1: delimsChanged
-13 -1: getFileSystem
-13 -1: METHOD_RETURN
-20 -1: sun/misc/PerfCounter
-61 -1: (Ljava/util/HashMap<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-8 -1: newIndex
-18 -1: getDisplayLanguage
-36 -1: (C)Ljava/lang/AbstractStringBuilder;
-36 -1: java/lang/StringCoding$StringEncoder
-12 -1: forEachEntry
-23 -1: [Ljava/io/Serializable;
-13 -1: totalCapacity
-26 -1: java/io/FileOutputStream$1
-14 -1: signatureArity
-90 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;[Ljava/security/cert/Certificate;)V
-17 -1: reflectionFactory
-6 -1: ibm737
-17 -1: fillInStackTrace0
-16 -1: allocateInstance
-52 -1: (Lsun/util/locale/BaseLocale$Key;)Ljava/lang/String;
-9 -1: addExtURL
-16 -1: copyFromIntArray
-65 -1: (Ljava/security/Permission;Z)Ljava/security/PermissionCollection;
-57 -1: java/util/concurrent/ConcurrentHashMap$SearchMappingsTask
-10 -1: toEpochDay
-4 -1: gate
-24 -1: sun/nio/cs/UTF_8$Decoder
-8 -1: entries2
-18 -1: isCharsetSupported
-10 -1: toCustomID
-2 -1: rw
-33 -1: java/nio/ByteBufferAsFloatBufferB
-25 -1: (ID)Ljava/nio/ByteBuffer;
-12 -1: addTimeOfDay
-61 -1: (Ljava/security/ProtectionDomain;Ljava/security/Permission;)Z
-2 -1: sd
-25 -1: (Ljava/net/InetAddress;)V
-33 -1: java/nio/ByteBufferAsFloatBufferL
-2 -1: se
-15 -1: hasQueuedThread
-24 -1: assertMemberIsConsistent
-37 -1: java/util/Collections$UnmodifiableMap
-2 -1: sp
-20 -1: setJavaUtilJarAccess
-96 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
-8 -1: language
-76 -1: <T:Ljava/lang/Object;>(Ljava/util/SortedSet<TT;>;)Ljava/util/SortedSet<TT;>;
-11 -1: findLibrary
-61 -1: (Ljava/lang/Class<*>;)Lsun/reflect/annotation/AnnotationType;
-6 -1: ([BZ)V
-24 -1: DEFAULT_BYTE_BUFFER_SIZE
-25 -1: (Ljava/util/ArrayList;I)V
-2 -1: th
-47 -1: (Ljava/util/Collection;)Ljava/util/Enumeration;
-49 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URL;
-7 -1: ([D[D)Z
-2 -1: to
-22 -1: java/util/Locale$Cache
-8 -1: iterator
-30 -1: (Ljava/lang/StringBuilder;IZ)V
-17 -1: ()Ljava/util/Set;
-2 -1: tr
-27 -1: (Ljava/nio/ByteBuffer;ISZ)V
-6 -1: method
-13 -1: allPermission
-9 -1: ruleArray
-8 -1: UTC_TIME
-10 -1: LF_COUNTER
-26 -1: Lsun/nio/cs/StreamDecoder;
-25 -1: ()Lsun/util/calendar/Era;
-6 -1: LOCHDR
-21 -1: sun/net/www/MimeTable
-12 -1: Cannot cast 
-2 -1: us
-2 -1: ut
-52 -1: Ljava/lang/invoke/MethodHandle$PolymorphicSignature;
-6 -1: encode
-15 -1: CharBuffer.java
-24 -1: (C)Ljava/nio/ByteBuffer;
-56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)V
-18 -1: getEnclosingMethod
-56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Z
-6 -1: ibm775
-9 -1: (IIIIII)I
-44 -1: ([JLjava/util/function/IntToLongFunction;I)V
-9 -1: (IIIIII)J
-64 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/LocaleExtensions;
-2 -1: x-
-2 -1: vm
-5 -1: clock
-9 -1: (IIIIII)V
-10 -1: XmlSupport
-19 -1: sun/nio/cs/US_ASCII
-10 -1: toRealPath
-5 -1: cp367
-6 -1: ST_END
-58 -1: [Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;
-12 -1: hasSameRules
-108 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/LocaleExtensions;
-22 -1: java/lang/Class$Atomic
-4 -1: sync
-6 -1: listen
-12 -1: firstElement
-142 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
-18 -1: internalProperties
-28 -1: (Ljava/lang/StringBuffer;C)V
-7 -1: factory
-18 -1: ()Ljava/util/List;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[D[DIIII)V
-44 -1: (Ljava/lang/Class;)Lsun/invoke/util/Wrapper;
-83 -1: (JLjava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)D
-12 -1: erasedType: 
-53 -1: (Ljava/util/AbstractList;Ljava/util/AbstractList$1;)V
-20 -1: Cannot find package 
-27 -1: java/util/ArrayList$ListItr
-10 -1: copyMethod
-23 -1: java/lang/ThreadLocal$1
-16 -1: iso_646.irv:1983
-42 -1: (Ljava/lang/Thread;Ljava/lang/Throwable;)V
-19 -1: DEFAULT_LOAD_FACTOR
-40 -1: ([Ljava/lang/Object;)[Ljava/lang/Object;
-10 -1: (JJJ[BII)I
-12 -1: singletonMap
-8 -1: RESERVED
-9 -1: zipAccess
-21 -1: SynchronizedSortedMap
-4 -1: flag
-15 -1: UnmodifiableSet
-18 -1: WrappedPrintWriter
-7 -1: resume0
-2 -1: yi
-10 -1: erasedType
-31 -1: CHECK_AWT_EVENTQUEUE_PERMISSION
-8 -1: <clinit>
-59 -1: (Ljava/lang/String;)Ljava/security/cert/CertificateFactory;
-40 -1: java/lang/management/MemoryManagerMXBean
-33 -1: newGetIntIllegalArgumentException
-16 -1: iso_646.irv:1991
-58 -1: (Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
-2 -1: zc
-26 -1: (Ljava/util/AbstractMap;)V
-6 -1: THROWS
-11 -1: toCharArray
-64 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
-2 -1: zh
-68 -1: Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;
-25 -1: (Ljava/util/Collection;)V
-20 -1: getJdkSpecialVersion
-17 -1: getTypeParameters
-32 -1: [Ljava/lang/ClassValue$Entry<*>;
-25 -1: (Ljava/util/Collection;)Z
-26 -1: Lsun/nio/ch/Interruptible;
-5 -1: 0.0p0
-5 -1: CACHE
-7 -1: namesOK
-21 -1: Ljava/lang/Exception;
-51 -1: (Ljava/net/URL;Lsun/net/www/protocol/jar/Handler;)V
-19 -1: jdk_special_version
-66 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;)Ljava/util/List<TT;>;
-75 -1: (Ljava/util/Comparator;Ljava/util/function/Function;)Ljava/util/Comparator;
-11 -1: Arrays.java
-19 -1: (Ljava/lang/Byte;)I
-17 -1: java/lang/Class$1
-17 -1: java/lang/Class$2
-17 -1: java/lang/Class$3
-47 -1: java/lang/invoke/MethodHandleImpl$WrappedMember
-17 -1: java/lang/Class$4
-44 -1: (Ljava/lang/Throwable;)Ljava/lang/Throwable;
-9 -1: charCount
-24 -1: ()Ljava/net/FileNameMap;
-44 -1: sun/util/locale/provider/TimeZoneNameUtility
-17 -1: not an array type
-2 -1: {}
-24 -1: (Lsun/misc/Launcher$1;)V
-12 -1: directMemory
-10 -1: parameters
-5 -1: java.
-14 -1: allocateDirect
-51 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuilder;
-23 -1: java/nio/file/Watchable
-37 -1: createDiagnosticFrameworkNotification
-54 -1: (Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodHandle;
-35 -1: sun/nio/cs/StandardCharsets$Aliases
-9 -1: retDelims
-11 -1: MAX_ENTRIES
-12 -1: CumulateTask
-64 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedKeyTask
-3 -1: iae
-12 -1: AF_PUTSTATIC
-21 -1: java/lang/Throwable$1
-45 -1: (Ljava/util/HashMap;)Ljava/util/HashMap$Node;
-77 -1: (JLjava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)I
-5 -1: after
-29 -1: (Ljava/security/CodeSource;)Z
-248 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-6 -1: H_URIC
-7 -1: L_DIGIT
-7 -1: toNanos
-24 -1: (D)Ljava/nio/ByteBuffer;
-25 -1: getDiagnosticCommandMBean
-6 2: [LFoo;
-14 -1: path.separator
-16 -1: toUnsignedString
-40 -1: DIRECTIONALITY_EUROPEAN_NUMBER_SEPARATOR
-87 -1: (Ljava/security/Permission;[Ljava/security/cert/Certificate;)Ljava/security/Permission;
-16 -1: inheritedChannel
-11 -1: audio/basic
-27 -1: sun.classloader.findClasses
-10 -1: queryCount
-20 -1: NF_ensureInitialized
-12 -1: getBufIfOpen
-23 -1: sun/nio/cs/UTF_16LE_BOM
-134 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/CallSite;
-17 -1: getImplMethodName
-14 -1: linkMethod => 
-25 -1: Ljava/lang/invoke/Stable;
-32 -1: Ljava/lang/annotation/Retention;
-7 -1: doInput
-9 -1: -_.!~*'()
-62 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;B)V
-18 -1: separateWithCommas
-43 -1: com/sun/crypto/provider/CipherBlockChaining
-14 -1: createTempFile
-9 -1: implFlush
-20 -1: getOffsetsByStandard
-21 -1: OutOfMemoryError.java
-7 -1: jce.jar
-46 -1: java/util/Collections$UnmodifiableNavigableMap
-30 -1: (Ljava/io/File;)Ljava/io/File;
-15 -1: LinkedList.java
-15 -1: iso_8859-9:1989
-50 -1: sun/reflect/generics/factory/CoreReflectionFactory
-10 -1: : JVM has 
-19 -1: HeapByteBuffer.java
-6 -1: getURL
-37 -1: java/security/cert/CertificateFactory
-23 -1: getAllowUserInteraction
-12 -1: otherParents
-25 -1: ARRAY_BOOLEAN_BASE_OFFSET
-9 -1: L_UPALPHA
-41 -1: ([Ljava/util/Hashtable$Entry<**>;TK;TV;)V
-6 -1: LOCHOW
-11 -1: access$1300
-30 -1: sun/reflect/MethodAccessorImpl
-130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/List<Ljava/util/Locale;>;
-9 -1: MALFORMED
-38 -1: (Ljava/lang/String;I)Ljava/lang/Short;
-26 -1: File format not recognised
-12 -1: setTimeOfDay
-19 -1: java/lang/Exception
-15 -1: getOutputStream
-74 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-41 -1: (Ljava/lang/String;Z)Ljava/util/TimeZone;
-49 -1: Lsun/reflect/generics/repository/ClassRepository;
-8 -1: getCerts
-90 -1: (Ljava/lang/Class<*>;ZLjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-5 -1: clone
-32 -1: ()Ljava/lang/ref/Reference$Lock;
-15 -1: caseIgnoreMatch
-23 -1: (Ljava/util/Set<TE;>;)V
-25 -1: enumerateStringProperties
-9 -1: inherited
-4 -1: flip
-8 -1: setMonth
-38 -1: (Ljava/util/function/Consumer<-TV;>;)V
-55 -1: java/util/concurrent/ConcurrentHashMap$ReduceValuesTask
-37 -1: getJavaSecurityProtectionDomainAccess
-67 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)Ljava/util/NavigableSet;
-10 -1: reduceKeys
-14 -1: MAX_CODE_POINT
-24 -1: getGenericExceptionTypes
-8 -1: fraction
-30 -1: java/lang/InterruptedException
-46 -1: (Ljava/lang/String;II[BI)Ljava/nio/ByteBuffer;
-114 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)V
-66 -1: (Ljava/lang/String;Ljava/lang/Throwable;)Ljava/lang/InternalError;
-45 -1: (Ljava/lang/Object;)Ljava/lang/StringBuilder;
-8 -1: putLongB
-101 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)Lsun/nio/cs/StreamDecoder;
-16 -1: standardProvider
-14 -1: parameterCount
-59 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/util/List;
-8 -1: putLongL
-12 -1: (TT;TV;TV;)Z
-37 -1: Lsun/reflect/ConstructorAccessorImpl;
-11 -1: ([CII[CII)V
-14 -1: parameterArray
-15 -1: | interpretName
-62 -1: (JLjava/util/function/Function;Ljava/util/function/Consumer;)V
-30 -1: (Z)Lsun/reflect/FieldAccessor;
-19 -1: jvm_special_version
-22 -1: java/util/ArrayDeque$1
-12 -1: initVersions
-22 -1: java/lang/CharSequence
-21 -1: NF_internalMemberName
-5 -1: ()TE;
-97 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;IZ)Ljava/lang/invoke/MethodHandle;
-25 -1: java/nio/MappedByteBuffer
-6 -1: addURL
-17 -1: isConvertibleFrom
-14 -1: extendWithType
-9 -1: interrupt
-11 -1: floorDivide
-16 -1: x-ISO-2022-CN-GB
-12 -1: CheckedQueue
-7 -1: setLong
-64 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;)V
-108 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-38 -1: java/nio/channels/spi/SelectorProvider
-17 -1: makeGuardWithTest
-20 -1: (Ljava/util/List;Z)V
-8 -1: val$path
-12 -1: Runtime.java
-7 -1: channel
-71 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/function/BinaryOperator<TT;>;)V
-18 -1: initializedHeaders
-32 -1: ()[Lsun/launcher/LauncherHelper;
-13 -1: jvInitialized
-10 -1: getSeconds
-7 -1: Decoder
-20 -1: getYearFromFixedDate
-6 -1: PREFIX
-21 -1: sun.boot.library.path
-11 -1: FIXED_DATES
-33 -1: (JLjava/util/function/Consumer;)V
-27 -1: initializeJavaAssertionMaps
-13 -1: toOctalString
-9 -1: fixResult
-10 -1: typeParams
-94 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)Ljava/util/concurrent/ConcurrentHashMap$Node;
-4 -1: Help
-11 -1: setIfNotSet
-39 -1: java/lang/UnsupportedOperationException
-15 -1: zip file closed
-8 -1: floorDiv
-10 -1: canExecute
-10 -1: encodeLoop
-18 -1: addRequestProperty
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)V
-10 -1: superclass
-5 -1: close
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)Z
-6 -1: ignore
-32 -1: ()Ljava/lang/ref/ReferenceQueue;
-19 -1: java/util/Formatter
-27 -1: java/lang/ClassLoaderHelper
-23 -1: (Ljava/lang/Object;JZ)V
-29 -1: java/nio/file/WatchEvent$Kind
-6 -1: CENLEN
-4 -1: SIZE
-68 -1: <T:Ljava/lang/Object;>(Ljava/util/Deque<TT;>;)Ljava/util/Queue<TT;>;
-9 -1: isEscaped
-12 -1: LF_INTERPRET
-22 -1: (I)Ljava/lang/Integer;
-60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-49 -1: ([Ljava/lang/Class<*>;Ljava/lang/StringBuilder;)V
-11 -1: getZipEntry
-16 -1: metaInfFilenames
-27 -1: (Ljava/lang/StringBuffer;)V
-57 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry<TK;TV;>;
-76 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-8 -1: ([CII)[B
-27 -1: (Ljava/lang/StringBuffer;)Z
-24 -1: getManifestFromReference
-8 -1: ([CII)[C
-10 -1: H_LOWALPHA
-18 -1: FileURLMapper.java
-12 -1: fxLaunchMode
-24 -1: isMethodHandleInvokeName
-17 -1: winTimeToFileTime
-19 -1: checkTopLevelWindow
-26 -1: MapReduceMappingsToIntTask
-13 -1: NORM_PRIORITY
-18 -1: lookupViaProviders
-30 -1: (I)Ljava/util/LinkedList$Node;
-3 -1: UTC
-10 -1: UNMAPPABLE
-68 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
-9 -1: META-INF/
-13 -1: Iterable.java
-71 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)Ljava/lang/reflect/Field;
-9 -1: setOffset
-8 -1: FJObject
-50 -1: (Ljava/lang/CharSequence;)Ljava/util/StringJoiner;
-23 -1: java/nio/HeapByteBuffer
-23 -1: sun/util/PreHashedMap$1
-23 -1: sun/util/PreHashedMap$2
-34 -1: newGetCharIllegalArgumentException
-40 -1: jca           JCA engine class debugging
-39 -1: (Ljava/lang/Object;I)Ljava/lang/Object;
-42 -1: (Ljava/lang/String;)Ljava/net/InetAddress;
-25 -1: (Ljava/net/FileNameMap;)V
-44 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap;
-52 -1: (Ljava/lang/String;Ljava/lang/Long;)Ljava/lang/Long;
-27 -1: ()[Ljava/util/HashMap$Node;
-29 -1: java/util/EmptyStackException
-16 -1: not a field type
-14 -1: Ljava/io/File;
-28 -1: ()[Ljava/security/Principal;
-69 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
-5 -1: ()TK;
-10 -1: ISO8859-13
-40 -1: java/lang/invoke/DirectMethodHandle$Lazy
-30 -1: The object is not initialized.
-10 -1: ISO8859-15
-88 -1: <E:Ljava/lang/Object;>(Ljava/util/List<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/List<TE;>;
-25 -1: (ZILjava/lang/String;II)Z
-9 -1: stackSize
-61 -1: (Ljava/util/Comparator;Ljava/lang/Object;Ljava/lang/Object;)I
-16 -1: synchronizedList
-90 -1: (Ljava/util/Comparator;Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
-9 -1: nullCheck
-174 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;>;
-14 -1: java/lang/Enum
-3 -1: int
-13 -1: detailMessage
-56 -1: java/util/concurrent/ConcurrentHashMap$SearchEntriesTask
-10 -1: ISO-8859-1
-10 -1: ISO-8859-2
-10 -1: ISO-8859-3
-10 -1: ISO-8859-4
-10 -1: ISO-8859-5
-10 -1: ISO-8859-6
-24 -1: ([Ljava/lang/Object;II)V
-10 -1: ISO-8859-7
-10 -1: ISO-8859-8
-139 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)[Ljava/util/concurrent/ConcurrentHashMap$Node;
-10 -1: ISO-8859-9
-5 -1: round
-25 -1: DIRECTIONALITY_WHITESPACE
-13 -1: NamedFunction
-10 -1: startAgent
-3 -1: ioe
-7 -1: closing
-24 -1: appendSchemeSpecificPart
-56 -1: sun/reflect/ReflectionFactory$GetReflectionFactoryAction
-83 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/reflect/ReflectionFactory;>;
-17 -1: isCharsetDetected
-11 -1: getJarFiles
-22 -1: getEnclosingMethodInfo
-11 -1: setReadable
-61 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)V
-10 -1: attachment
-34 -1: (Ljava/io/File;)Ljava/lang/String;
-18 -1: ZipFileInputStream
-15 -1: CodeSource.java
-61 -1: (Ljava/util/jar/JarFile;)Ljava/util/List<Ljava/lang/Object;>;
-7 -1: cp00858
-108 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;II)Ljava/lang/invoke/LambdaForm$Name;
-38 -1: ([DII)Ljava/util/Spliterator$OfDouble;
-8 -1: val$name
-11 -1: LF_REINVOKE
-12 -1: validateTime
-17 -1: copyFromCharArray
-32 -1: throwSetIllegalArgumentException
-14 -1: fieldModifiers
-52 -1: (Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry;
-58 -1: (Ljava/io/OutputStream;Ljava/nio/charset/CharsetEncoder;)V
-14 -1: generalInvoker
-11 -1: interrupted
-246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask;Ljava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)V
-20 -1: java/util/Dictionary
-17 -1: getDoubleVolatile
-41 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Z
-8 -1: intValue
-24 -1: (F)Ljava/nio/ByteBuffer;
-5 -1: reset
-54 -1: (ILjava/util/List;)[Ljava/lang/invoke/LambdaForm$Name;
-19 -1: [Ljava/util/Locale;
-43 -1: (Ljava/lang/String;II)Ljava/nio/ByteBuffer;
-38 -1: ()Ljava/io/ObjectInputStream$GetField;
-18 -1: [Locked by thread 
-10 -1: checkedMap
-16 -1: checkedSortedMap
-14 -1: illegal symbol
-16 -1: TITLECASE_LETTER
-4 -1: root
-22 -1: (ZLjava/lang/String;)V
-27 -1: ([JII)Ljava/nio/LongBuffer;
-15 -1: printStackTrace
-30 -1: newConstructorForSerialization
-14 -1: getPermissions
-13 -1: toStringCache
-15 -1: equalParamTypes
-37 -1: throwFinalFieldIllegalAccessException
-35 -1: (Ljava/lang/String;Ljava/io/File;)V
-34 -1: java/nio/charset/CoderResult$Cache
-3 -1: .\n\n
-33 -1: Ljava/nio/charset/CharsetEncoder;
-11 -1: lambdaForms
-65 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)TT;
-39 -1: (CLjava/lang/Class;Ljava/lang/Object;)Z
-3 -1: ise
-14 -1: forLanguageTag
-45 -1: ([Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Z
-36 -1: RuntimeInvisibleParameterAnnotations
-12 -1: binarySearch
-24 -1: getAssociatedAnnotations
-10 -1: decoderFor
-6 -1: ibm813
-10 -1: logicalXor
-10 -1: setVarargs
-71 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;Ljava/lang/Void;)V
-4 -1: cast
-6 -1: ibm819
-23 -1: getParentDelegationTime
-8 -1: ([FII)[F
-4 -1: .tmp
-6 -1: (JII)J
-27 -1: ()Ljava/lang/ref/Finalizer;
-9 -1: sunec.jar
-22 -1: java/net/URLConnection
-41 -1: (Ljava/lang/Runnable;Ljava/lang/String;)V
-20 -1: SecurityManager.java
-18 -1: getZipFileOpenTime
-7 -1: country
-13 -1: inflaterCache
-4 -1:     
-17 -1: java/lang/Runtime
-125 -1: (Lsun/management/GcInfoBuilder;JJJ[Ljava/lang/management/MemoryUsage;[Ljava/lang/management/MemoryUsage;[Ljava/lang/Object;)V
-24 -1: java/util/ResourceBundle
-64 -1: Ljava/util/Hashtable<Lsun/misc/Signal;Lsun/misc/SignalHandler;>;
-79 -1: ([Ljava/util/WeakHashMap$Entry<TK;TV;>;[Ljava/util/WeakHashMap$Entry<TK;TV;>;)V
-8 -1: x-ibm737
-39 -1: (Ljava/security/AccessControlContext;)Z
-21 -1: (Ljava/lang/Class;I)V
-4 -1:    -
-15 -1: calculateFields
-22 -1: Ljava/util/Properties;
-8 -1: getArray
-21 -1: (Ljava/lang/Class;I)Z
-41 -1: (Ljava/lang/ThreadGroup;)Ljava/lang/Void;
-17 -1: Ljava/io/Console;
-115 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
-12 -1: nextThreadID
-81 -1: (Ljava/net/URLClassLoader;Ljava/lang/SecurityManager;Ljava/security/Permission;)V
-23 -1: ARRAY_SHORT_BASE_OFFSET
-10 -1: interpret_
-144 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-20 -1: isIPv6LiteralAddress
-13 -1: launcher_name
-36 -1: java/util/function/IntToLongFunction
-38 -1: java/util/WeakHashMap$EntrySpliterator
-8 -1: copyInto
-3 -1: ACT
-11 -1: metafactory
-31 -1: ([BLjava/nio/charset/Charset;)V
-30 -1: java/lang/annotation/Retention
-13 -1: getYearLength
-42 -1: java/util/AbstractMap$SimpleImmutableEntry
-31 -1: ()Ljava/lang/invoke/MemberName;
-21 -1: sun/misc/JavaIOAccess
-16 -1: jdk_build_number
-8 -1: ST_RESET
-96 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-13 -1: getTypeString
-15 -1: maxCharsPerByte
-8 -1: checkKey
-49 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/UTF_8$1;)V
-80 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
-32 -1: Ljava/security/ProtectionDomain;
-5 -1: ()TT;
-6 -1: insert
-10 -1: intersects
-38 -1: ([Ljava/lang/Class;Ljava/lang/Class;)V
-15 -1: java/lang/Class
-12 -1: getPublicKey
-37 -1: (ID)Ljava/lang/AbstractStringBuilder;
-6 -1: ibm850
-6 -1: locsig
-6 -1: ibm852
-19 -1: changeReferenceKind
-3 -1: AET
-42 -1: (Ljava/util/Collection;Ljava/lang/Class;)V
-6 -1: ibm855
-16 -1: getPolicyNoCheck
-39 -1: ([B)[[Ljava/lang/annotation/Annotation;
-6 -1: ibm857
-10 -1: Error.java
-38 -1: ()Ljava/util/List<Ljava/lang/Object;>;
-14 -1: createInstance
-5 -1: cp437
-28 -1: Lsun/util/locale/BaseLocale;
-17 -1: getStandardOffset
-29 -1: sun/nio/cs/StandardCharsets$1
-36 -1: Ljava/security/ProtectionDomain$Key;
-14 -1: ArrayList.java
-78 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-38 -1: java/lang/invoke/MethodHandleImpl$Lazy
-42 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
-8 -1: getLongB
-7 -1: vmentry
-21 -1: lookupExtendedCharset
-32 -1: <T:Ljava/lang/Object;>([TT;)[TT;
-53 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView;
-6 -1: ibm862
-8 -1: getLongL
-32 -1: (Ljava/lang/invoke/MemberName;)J
-67 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Perf;>;
-6 -1: region
-6 -1: ibm866
-89 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/ConstructorAccessor;
-22 -1: java/util/ListIterator
-9 -1: wednesday
-16 -1: unsuspendThreads
-20 -1: Not a Proxy instance
-45 -1: Ljava/lang/reflect/InvocationTargetException;
-61 -1: (Ljava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
-5 -1: ()TV;
-32 -1: (Ljava/lang/invoke/MemberName;)V
-82 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/cert/Certificate;
-34 -1: java/lang/ClassValue$ClassValueMap
-32 -1: (Ljava/lang/invoke/MemberName;)Z
-15 -1: SPACE_SEPARATOR
-17 -1: caseIgnoreCompare
-58 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandles$Lookup;
-4 -1: Code
-3 -1: AGT
-54 -1: (Ljava/lang/StringBuilder;II)Ljava/lang/StringBuilder;
-6 -1: ibm874
-15 -1: newMemberBuffer
-42 -1: (Ljava/nio/file/Path;)Ljava/nio/file/Path;
-33 -1: Ljava/lang/NumberFormatException;
-10 -1: Field.java
-67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;)TU;
-4 -1: rows
-12 -1: MIN_PRIORITY
-25 -1: URI has a query component
-41 -1: provider      security provider debugging
-29 -1: sun/nio/cs/ISO_8859_1$Encoder
-26 -1: (Ljava/util/zip/ZipFile;)I
-26 -1: (Ljava/util/zip/ZipFile;)J
-20 -1: Bad digit at end of 
-29 -1: Ljava/lang/RuntimePermission;
-12 -1: initResolved
-9 -1: loadFence
-13 -1: fieldAccessor
-26 -1: (Ljava/util/zip/ZipFile;)V
-36 -1: java/lang/CloneNotSupportedException
-19 -1: getBasicConstraints
-16 -1: putOrderedObject
-26 -1: (Ljava/util/zip/ZipFile;)Z
-6 -1: target
-50 -1: (Ljava/util/concurrent/CountedCompleter;[I[IIIII)V
-16 -1: changeReturnType
-13 -1: CAUSE_CAPTION
-14 -1: checkExactType
-50 -1: sun/util/locale/provider/LocaleServiceProviderPool
-47 -1: java/lang/invoke/DirectMethodHandle$Constructor
-20 -1: CallerSensitive.java
-30 -1: java/security/ProtectionDomain
-26 -1: java.launcher.opt.vmselect
-4 -1: \tat 
-42 -1: java/util/ArraysParallelSortHelpers$FJLong
-39 -1: (Ljava/lang/String;)[Ljava/lang/String;
-19 -1: sun.net.www.content
-34 -1: ([III)Ljava/util/stream/IntStream;
-20 -1: (Ljava/util/Deque;)V
-35 -1: (Ljava/lang/reflect/Constructor;)[B
-16 -1: WeakHashMap.java
-8 -1: ([III)[I
-46 -1: (Ljava/util/Properties;Ljava/io/InputStream;)V
-54 -1: (I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-65 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node;
-27 -1: URI path component is empty
-3 -1: -1-
-32 -1: Ljava/io/InterruptedIOException;
-9 -1: setLocale
-7 -1: [^, ;]*
-6 -1: format
-61 -1: (Ljava/util/function/Supplier;IZ)Ljava/util/stream/IntStream;
-20 -1: getRequestProperties
-16 -1: reallocateMemory
-28 -1: java/lang/IllegalAccessError
-5 -1: query
-83 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;II)Ljava/lang/invoke/MethodHandle;
-7 -1: threadQ
-6 -1: STATIC
-7 -1: enqueue
-21 -1: uninitializedCallSite
-3 -1: -2-
-26 -1: ()Ljava/util/NavigableSet;
-27 -1: getUncaughtExceptionHandler
-42 -1: ([Ljava/net/URL;)Ljava/net/URLClassLoader;
-30 -1: java/lang/UnsatisfiedLinkError
-39 -1: java/util/Collections$ReverseComparator
-7 -1: resolve
-4 -1: poll
-7 -1: (TE;I)V
-21 -1: : Unknown launch mode
-53 -1: (Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-36 -1: sun.classloader.parentDelegationTime
-25 -1: java/net/URLStreamHandler
-39 -1: (Ljava/lang/Object;J)Ljava/lang/Object;
-53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
-51 -1: java/util/ArraysParallelSortHelpers$FJDouble$Sorter
-26 -1: getAnnotatedParameterTypes
-18 -1: codePointCountImpl
-7 -1: threads
-12 -1: offsetBefore
-29 -1: ()Ljava/util/Collection<TV;>;
-58 -1: (Lsun/invoke/util/Wrapper;)Ljava/lang/invoke/MethodHandle;
-17 -1: DMH.invokeSpecial
-3 -1: -3-
-16 -1: decodeBufferLoop
-43 -1: java/util/concurrent/atomic/AtomicReference
-16 -1: reduceKeysToLong
-27 -1: newIllegalArgumentException
-3 -1: ALL
-5 -1: cache
-5 -1: queue
-4 -1: 8bit
-3 -1: -4-
-35 -1: Ljava/util/Set<Ljava/lang/String;>;
-9 -1: MIN_RADIX
-26 -1: ZipFileInflaterInputStream
-13 -1: MANIFEST_NAME
-18 -1: java/util/TimeZone
-175 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/DirectMethodHandle$1;)V
-16 -1: getContentLength
-11 -1: setDoOutput
-22 -1: (Ljava/io/Closeable;)V
-13 -1: TimeZone.java
-28 -1: sun/misc/ExtensionDependency
-6 -1: bindTo
-3 -1: -5-
-40 -1: ()[Ljava/util/WeakHashMap$Entry<TK;TV;>;
-20 -1: ()Lsun/misc/Cleaner;
-9 -1: compareTo
-68 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask
-11 -1: checkedList
-14 -1: (ITK;TV;ZZ)TV;
-5 -1: greek
-3 -1: jar
-21 -1: (Ljava/lang/String;)B
-21 -1: (Ljava/lang/String;)C
-21 -1: (Ljava/lang/String;)D
-5 -1: (JS)V
-21 -1: (Ljava/lang/String;)F
-13 -1: LETTER_NUMBER
-14 -1: isAlphaNumeric
-21 -1: (Ljava/lang/String;)I
-73 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;Ljava/lang/StringCoding$1;)V
-21 -1: (Ljava/lang/String;)J
-25 -1: makeExactOrGeneralInvoker
-3 -1: -6-
-25 -1: java/nio/StringCharBuffer
-21 -1: Ljava/util/Hashtable;
-8 -1: ENQUEUED
-8 -1: finalize
-22 -1: DirectLongBufferU.java
-21 -1: (Ljava/lang/String;)S
-10 -1: localhost:
-33 -1: isKnownNotToHaveSpecialAttributes
-21 -1: (Ljava/lang/String;)V
-45 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)V
-21 -1: (Ljava/lang/String;)Z
-22 -1: (Ljava/util/Vector;I)V
-44 -1: java/nio/charset/UnsupportedCharsetException
-23 -1: java/lang/CharacterName
-7 -1: checkIO
-33 -1: (I)Lsun/misc/URLClassPath$Loader;
-90 -1: (Ljava/lang/Class<*>;Ljava/lang/reflect/Constructor<*>;)Ljava/lang/reflect/Constructor<*>;
-18 -1: getHeaderFieldDate
-9 -1: MIN_VALUE
-95 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Ljava/util/Collection;
-44 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration;
-8 -1: NOVEMBER
-4 -1: gcal
-17 -1: getConnectTimeout
-124 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
-24 -1: INDEXOFSUBLIST_THRESHOLD
-16 -1: isJulianLeapYear
-21 -1: reduceEntriesToDouble
-15 -1: getPrefixLength
-17 -1:  is not param at 
-14 -1: inDaylightTime
-39 -1: (Ljava/lang/Class;[I)Ljava/lang/Object;
-5 -1: force
-98 -1: (Ljava/lang/Class;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-40 -1: (Lsun/reflect/ConstructorAccessorImpl;)V
-27 -1: RuntimeInvisibleAnnotations
-17 -1: checkTargetChange
-9 -1: skipBytes
-4 -1: port
-25 -1: sun/nio/cs/UTF_16$Encoder
-28 -1: MIN_SUPPLEMENTARY_CODE_POINT
-4 -1: node
-11 -1: not param: 
-9 -1: debugInit
-6 -1: setURL
-14 -1: getMonthLength
-23 -1: ()Ljava/nio/ByteBuffer;
-17 -1: CALENDAR_JAPANESE
-11 -1: access$1400
-16 -1: ()Ljava/net/URI;
-29 -1: (IZ)Ljava/lang/StringBuilder;
-15 -1: Native Library 
-30 -1: Invalid lambda deserialization
-14 -1: throwException
-18 -1: nothing to verify!
-23 -1: (Ljava/lang/Object;JF)V
-3 -1: ART
-16 -1: isExtClassLoader
-18 -1: Illegal Capacity: 
-26 -1: java/util/zip/ZipException
-4 -1: /../
-34 -1: ([II)Ljava/util/Spliterator$OfInt;
-26 -1: (I)Ljava/util/Enumeration;
-60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-43 -1: not a field or nested class, no simple type
-12 -1: nextPutIndex
-15 -1: getConstructor0
-3 -1: AST
-11 -1: fromURIPath
-49 -1: (Ljava/util/Collections$UnmodifiableCollection;)V
-8 -1: makeImpl
-51 -1: (Ljava/util/WeakHashMap;Ljava/util/WeakHashMap$1;)V
-32 -1: (Ljava/util/function/Supplier;)V
-20 -1: namedFunctionInvoker
-37 -1: newGetBooleanIllegalArgumentException
-19 -1: (Ljava/io/File;ZI)V
-8 -1: NULL_KEY
-36 -1: Ljava/lang/reflect/Constructor<TT;>;
-21 -1: (Ljava/lang/Object;)B
-21 -1: (Ljava/lang/Object;)C
-21 -1: (Ljava/lang/Object;)D
-21 -1: (Ljava/lang/Object;)F
-30 -1: ()Lsun/util/locale/BaseLocale;
-21 -1: (Ljava/lang/Object;)I
-21 -1: (Ljava/lang/Object;)J
-10 -1: lineNumber
-95 -1: (JLjava/util/function/ToDoubleBiFunction<-TK;-TV;>;DLjava/util/function/DoubleBinaryOperator;)D
-16 -1: CoderResult.java
-44 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)V
-21 -1: (Ljava/lang/Object;)S
-13 -1: getNameString
-129 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/DirectMethodHandle$1;)V
-21 -1: (Ljava/lang/Object;)V
-21 -1: (Ljava/lang/Object;)Z
-81 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;
-49 -1: java/util/concurrent/locks/ReentrantLock$FairSync
-11 -1: csisolatin0
-11 -1: csisolatin1
-7 -1: isSpace
-10 -1: getDefault
-11 -1: csisolatin2
-16 -1: ()Ljava/net/URL;
-11 -1: csisolatin4
-14 -1: invokeExact_MT
-11 -1: csisolatin5
-28 -1: (Ljava/io/FileInputStream;)V
-11 -1: csisolatin9
-8 -1: isLetter
-15 -1: getConstructors
-21 -1: mainAppContextDefault
-29 -1: ()[Ljava/lang/reflect/Method;
-23 -1: Ljava/util/WeakHashMap;
-12 -1: LF_INVSTATIC
-17 -1: DirectBuffer.java
-10 -1: newEncoder
-10 -1: getVersion
-32 -1: java/lang/IllegalAccessException
-20 -1: java/util/Collection
-61 -1: (Ljava/util/concurrent/ConcurrentHashMap;Ljava/lang/Object;)V
-19 -1: $deserializeLambda$
-8 -1: removeIf
-25 -1: sun/reflect/FieldAccessor
-129 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
-17 -1: parseAbsoluteSpec
-37 -1: ([Ljava/util/HashMap$Node<TK;TV;>;I)V
-17 -1: java/util/HashSet
-13 -1: spreadInvoker
-20 -1: suppressAccessChecks
-32 -1: Ljava/lang/InterruptedException;
-11 -1: oldMappings
-9 -1: lookupTag
-16 -1: java/lang/System
-5 -1: LFI: 
-6 -1: IBM737
-9 -1: SHORT_IDS
-45 -1: ([IIILjava/util/function/IntBinaryOperator;)V
-20 -1: getMetaInfEntryNames
-10 -1: isReadOnly
-50 -1: <E:Ljava/lang/Object;>()Ljava/util/SortedSet<TE;>;
-12 -1: java.vm.name
-30 -1: java/lang/Class$AnnotationData
-61 -1: (ILjava/lang/invoke/LambdaForm;)Ljava/lang/invoke/LambdaForm;
-7 -1: address
-44 -1: (Ljava/util/function/BiConsumer<-TK;-TV;>;)V
-58 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)V
-112 -1: (Ljava/lang/Object;TV;Ljava/lang/ref/ReferenceQueue<Ljava/lang/Object;>;ILjava/util/WeakHashMap$Entry<TK;TV;>;)V
-14 -1: aliases_KOI8_R
-3 -1: AWT
-14 -1: aliases_KOI8_U
-24 -1: ARRAY_DOUBLE_BASE_OFFSET
-23 -1: Ljava/util/jar/JarFile;
-91 -1: (Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)V
-14 -1: mappingAddress
-19 -1: [Ljava/lang/Object;
-17 -1: sun/misc/JarIndex
-9 -1: image/jpg
-49 -1: (Ljava/lang/String;I)Lsun/util/calendar/ZoneInfo;
-37 -1: java/lang/invoke/DirectMethodHandle$1
-34 -1: java/util/Collections$SingletonMap
-89 -1: (JLjava/util/function/ToIntBiFunction<-TK;-TV;>;ILjava/util/function/IntBinaryOperator;)I
-46 -1: (Ljava/util/Comparator;)Ljava/util/Comparator;
-11 -1: isTitleCase
-38 -1: java/lang/IllegalMonitorStateException
-33 -1: java/nio/BufferUnderflowException
-28 -1: java/lang/ClassValue$Version
-11 -1: printLocale
-13 -1: STORE_BARRIER
-42 -1: ([ILjava/util/function/IntUnaryOperator;)V
-26 -1: sun/util/locale/BaseLocale
-29 -1: java/io/ObjectStreamException
-41 -1: sun/reflect/UnsafeStaticFieldAccessorImpl
-60 -1: ([Ljava/lang/Object;Ljava/util/Iterator;)[Ljava/lang/Object;
-30 -1: (Ljava/nio/charset/Charset;)[B
-73 -1: ([Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
-3 -1: VST
-80 -1: Java(TM) SE Runtime Environment (build 1.8.0-internal-iklam_2013_11_27_21_25-b00
-85 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/net/URLStreamHandler;)V
-20 -1: getStackTraceElement
-36 -1: java/util/LinkedHashMap$LinkedKeySet
-17 -1: getNormalizedYear
-15 -1: maxBytesPerChar
-16 -1: java/util/Random
-34 -1: (I[C)Ljava/lang/invoke/LambdaForm;
-11 -1: nbits < 0: 
-7 -1: H_PCHAR
-29 -1: (Ljava/nio/charset/Charset;)I
-36 -1: (I[I[C)Ljava/lang/invoke/LambdaForm;
-23 -1: java/lang/ClassLoader$1
-23 -1: java/lang/ClassLoader$2
-23 -1: java/lang/ClassLoader$3
-9 -1: sizeTable
-36 -1: (Z)Ljava/lang/AbstractStringBuilder;
-29 -1: (Ljava/nio/charset/Charset;)V
-25 -1: ARRAY_BOOLEAN_INDEX_SCALE
-29 -1: (Ljava/nio/charset/Charset;)Z
-6 -1: keySet
-20 -1: declaredConstructors
-25 -1: oracle/jrockit/jfr/Timing
-12 -1: sizeIsSticky
-6 -1: IBM775
-17 -1: currentTimeMillis
-28 -1: java/nio/DirectDoubleBufferS
-71 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
-28 -1: java/nio/DirectDoubleBufferU
-19 -1: cachedFixedDateJan1
-15 -1: getClassContext
-65 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;)V
-16 -1: unmodifiableList
-10 -1: getDoubleB
-82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
-11 -1: getEntryCrc
-10 -1: getDoubleL
-20 -1: (C)Ljava/lang/Class;
-11 -1: Null action
-22 -1: java/io/BufferedWriter
-67 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
-22 -1: parseSelectAnnotations
-6 -1: rename
-20 -1: acquireFieldAccessor
-43 -1: (Ljava/util/Vector;[Ljava/lang/Object;III)V
-32 -1: Ljava/lang/NullPointerException;
-29 -1: (Ljava/lang/ThreadLocal<*>;)V
-18 -1: descendingIterator
-37 -1: java/util/Collections$SynchronizedSet
-24 -1: mark/reset not supported
-12 -1: ) > toIndex(
-13 -1: <<ALL FILES>>
-10 -1: fastRemove
-4 -1: load
-31 -1: sun/reflect/ReflectionFactory$1
-39 -1: (Ljava/util/List<*>;)Ljava/lang/Object;
-39 -1: Ljava/util/Map<TE;Ljava/lang/Boolean;>;
-9 -1: offerLast
-31 -1: ()Ljava/lang/invoke/MethodType;
-40 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;
-17 -1: getObjectVolatile
-14 -1: suspendThreads
-55 -1: (Ljava/lang/String;ZLjava/util/Set;)Lsun/misc/Resource;
-75 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+Ljava/lang/Comparable<-TT;>;>;TT;)I
-6 -1: Lookup
-20 -1: java/io/OutputStream
-41 -1: Could not create application class loader
-28 -1: Lsun/misc/JavaUtilJarAccess;
-46 -1: java/util/Collections$SynchronizedNavigableSet
-8 -1: override
-21 -1: threadLocalRandomSeed
-10 -1: TEXT_PLAIN
-22 -1: ([B)Ljava/lang/String;
-29 -1: java/nio/InvalidMarkException
-14 -1: Throwable.java
-27 -1: newWrongMethodTypeException
-6 -1: ptypes
-8 -1: bugLevel
-62 -1: (ILjava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
-37 -1: ()Ljava/util/Locale$LocaleNameGetter;
-14 -1: getEntryMethod
-7 -1: getByte
-12 -1: UTF-32BE-BOM
-4 -1: lock
-34 -1: java/security/AccessControlContext
-79 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MemberName;
-5 -1: DEBUG
-5 -1: unbox
-17 -1: CLASSPATH_OPTOSFT
-4 -1: cbrt
-21 -1: LocalizedObjectGetter
-21 -1: ProtectionDomain.java
-22 -1: ([J)Ljava/util/BitSet;
-17 -1: getUnresolvedName
-34 -1: (Ljava/util/Map;Ljava/util/Map;I)V
-7 -1: cskoi8r
-14 -1: getInterfaces0
-48 -1: (Lsun/net/www/MessageHeader;)[Ljava/lang/String;
-14 -1: getFileNameMap
-16 -1: preserveCombiner
-19 -1: getDefaultUseCaches
-57 -1: (Ljava/lang/Class;[B[Ljava/lang/Object;)Ljava/lang/Class;
-21 -1: (D)Ljava/lang/Double;
-15 -1: iso8859_15_fdis
-23 -1: java/util/regex/Pattern
-6 -1: ibm912
-14 -1: findBuiltinLib
-42 -1: java/lang/annotation/AnnotationFormatError
-6 -1: ibm914
-6 -1: ibm915
-44 -1: java/nio/charset/IllegalCharsetNameException
-22 -1: COMBINING_SPACING_MARK
-20 -1: ()Ljava/lang/Thread;
-8 -1: readLine
-12 -1: (unresolved 
-65 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Lsun/misc/Resource;>;
-41 -1: ([Ljava/lang/String;[Ljava/lang/String;)V
-30 -1: java/lang/Class$ReflectionData
-8 -1: requests
-52 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/US_ASCII$1;)V
-12 -1: ACCESS_WRITE
-6 -1: ibm920
-12 -1: CR_ERROR_MIN
-6 -1: jarMap
-6 -1: ibm923
-15 -1: java/lang/Error
-11 -1: VM_SETTINGS
-18 -1: name can't be null
-7 -1: PRESENT
-19 -1: setSecurityManager0
-101 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)Lsun/nio/cs/StreamEncoder;
-25 -1: ()Ljava/util/jar/JarFile;
-26 -1: java/io/ObjectOutputStream
-13 -1: no !/ in spec
-5 -1: (II)C
-12 -1: setPriority0
-30 -1: (Z)[Ljava/lang/reflect/Method;
-28 -1: sun/nio/cs/ThreadLocalCoders
-5 -1: (II)I
-22 -1: java/io/BufferedReader
-26 -1: ()Lsun/misc/JavaNetAccess;
-10 -1: Asia/Dhaka
-14 -1: parallelStream
-5 -1: (II)V
-5 -1: (II)Z
-31 -1: Ljava/lang/reflect/Constructor;
-21 -1: ()Ljava/time/Instant;
-31 -1: (Ljava/lang/String;III[J[I[IZ)V
-8 -1: Volatile
-23 -1: isUnicodeIdentifierPart
-27 -1: longPrimitiveParameterCount
-16 -1: Map is non-empty
-24 -1: getLocalizedOutputStream
-14 -1: java/lang/Byte
-10 -1: staticBase
-11 -1: lastElement
-17 -1: replaceStaleEntry
-17 -1: MAX_LOW_SURROGATE
-28 -1: java.launcher.X.macosx.usage
-20 -1: registerShutdownHook
-16 -1: SECOND_IN_MILLIS
-8 -1: Embedded
-16 -1: BootstrapMethods
-14 -1: numInvocations
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Enumeration<TT;>;
-10 -1: rotateLeft
-46 -1: ([Ljava/lang/Object;)Ljava/util/stream/Stream;
-6 -1: verify
-17 -1: OTHER_PUNCTUATION
-26 -1: acquireConstructorAccessor
-38 -1: (Ljava/lang/String;I)Ljava/lang/Class;
-30 -1: java/net/UnknownContentHandler
-20 -1: PREFIX_LENGTH_OFFSET
-12 -1: nextGetIndex
-14 -1: standardOffset
-10 -1: entryNames
-15 -1: application/xml
-3 -1: BET
-39 -1: ([DIII)Ljava/util/Spliterator$OfDouble;
-83 -1: (JLjava/util/function/BiFunction;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-10 -1: initMethod
-47 -1: (Ljava/util/LinkedList$Node;)Ljava/lang/Object;
-8 -1: isSealed
-12 -1: isAccessible
-11 -1: audio/x-wav
-46 -1: (Ljava/lang/String;)Ljava/util/jar/Attributes;
-24 -1: ()Ljava/io/OutputStream;
-15 -1: FIELD_MODIFIERS
-30 -1: sun/misc/URLClassPath$Loader$1
-20 -1: recursive invocation
-34 -1: (Ljava/lang/String;)Ljava/net/URL;
-12 -1: linkNodeLast
-34 -1: call site initialization exception
-17 -1: casAnnotationType
-8 -1: x-ibm874
-7 -1: isUpper
-58 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesTask
-31 -1: Ill-formed Unicode locale key: 
-12 -1: defineClass0
-12 -1: defineClass1
-12 -1: defineClass2
-59 -1: Can not call newInstance() on the Class for java.lang.Class
-10 -1: codePoints
-3 -1: ...
-14 -1: readAheadLimit
-14 -1: parallelSetAll
-41 -1: ([Ljava/lang/Object;I)[Ljava/lang/Object;
-148 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set<Ljava/lang/Throwable;>;)V
-10 -1: Deque.java
-21 -1: Must be volatile type
-7 -1: setForm
-58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Byte;>;
-47 -1: (Ljava/lang/String;Ljava/security/CodeSource;)V
-30 -1: java/io/InterruptedIOException
-44 -1: java/util/Collections$SynchronizedCollection
-16 -1: Invalid Jar file
-32 -1: sun/util/calendar/CalendarSystem
-67 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
-19 -1: DEFAULT_BUFFER_SIZE
-16 -1: readObjectNoData
-16 -1: setJavaNioAccess
-73 -1: (Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/Object;)Ljava/lang/Object;
-14 -1: copyToIntArray
-10 -1: hasWaiters
-20 -1: (I)Ljava/lang/Class;
-35 -1: all           turn on all debugging
-14 -1: Invalid host: 
-26 -1: Lsun/nio/cs/StreamEncoder;
-43 -1: sun/misc/JavaSecurityProtectionDomainAccess
-11 -1: getNamedCon
-8 -1: H_SERVER
-27 -1: java/util/function/Consumer
-12 -1: isLocalClass
-81 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
-83 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Boolean;>;
-4 -1: exec
-43 -1: java/lang/reflect/InvocationTargetException
-35 -1: (Ljava/io/File;Ljava/lang/String;)V
-9 -1: modifiers
-35 -1: (Ljava/io/File;Ljava/lang/String;)Z
-9 -1: Byte.java
-12 -1: unknown mode
-18 -1: initializeVerifier
-24 -1: (Ljava/nio/ByteBuffer;)I
-22 -1: ([Ljava/lang/Object;)I
-11 -1: correctType
-6 -1: escape
-52 -1: (Ljava/security/ProtectionDomain;)Ljava/lang/String;
-11 -1: annotations
-121 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-22 -1:  using an instance of 
-14 -1: getSpeciesData
-28 -1: ()Ljava/security/CodeSource;
-12 -1: JZENTRY_NAME
-24 -1: (Ljava/nio/ByteBuffer;)V
-4 -1: ZBSC
-22 -1: ([Ljava/lang/Object;)V
-7 -1: isParam
-165 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/LambdaForm;
-24 -1: Ljava/io/FilePermission;
-22 -1: ([Ljava/lang/Object;)Z
-11 -1: mergeHeader
-11 -1: applyAsLong
-28 -1: (IJ)Ljava/lang/StringBuffer;
-10 -1: arityCheck
-52 -1: (ILjava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-13 -1: toUpperCaseEx
-9 -1: nextIndex
-11 -1: start > end
-4 -1: long
-6 -1: Static
-27 -1: ()Ljava/lang/reflect/Field;
-10 -1: bufUpdater
-43 -1: averageBytesPerChar exceeds maxBytesPerChar
-105 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
-23 -1: ARRAY_SHORT_INDEX_SCALE
-15 -1: getHeaderFields
-36 -1: java/util/HashMap$HashMapSpliterator
-10 -1: Guard.java
-29 -1: java/util/RandomAccessSubList
-6 -1: addAll
-7 -1: getTime
-16 -1: invokeHandleForm
-32 -1: sun/util/locale/LocaleExtensions
-16 -1: checkAndLoadMain
-19 -1: INTERFACE_MODIFIERS
-11 -1: resolveName
-20 -1: getContentLengthLong
-53 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-19 -1: name cannot be null
-23 -1: hasReceiverTypeDispatch
-12 -1: getExtension
-49 -1: Ljava/util/Set<Ljava/security/ProtectionDomain;>;
-114 -1: (Ljava/lang/String;[J[I[J[I[Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)Lsun/util/calendar/ZoneInfo;
-24 -1: NativeSignalHandler.java
-58 -1: (Ljava/lang/Thread;)Ljava/lang/ThreadLocal$ThreadLocalMap;
-10 -1: interface 
-68 -1: (Ljava/lang/String;)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
-15 -1: addShutdownHook
-32 -1: java/security/AccessController$1
-10 -1: filterTags
-19 -1: [Ljava/lang/Number;
-92 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-43 -1: java/util/LinkedHashMap$LinkedEntryIterator
-5 -1: utf-8
-11 -1: iso-8859-13
-11 -1: iso-8859-15
-58 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/jar/JarFile;
-41 -1:               CertPathValidator debugging
-22 -1: ARRAY_LONG_BASE_OFFSET
-57 -1: (Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: queuePrintJob
-14 -1: Watchable.java
-15 -1: jdkMajorVersion
-62 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMXBean;
-23 -1: twoToTheDoubleScaleDown
-22 -1: registerVMNotification
-30 -1: ()Lsun/misc/JavaUtilJarAccess;
-17 -1: getTargetVolatile
-4 -1: exit
-13 -1: StringDecoder
-12 -1: hasRemaining
-9 -1: bigEndian
-14 -1: checkMulticast
-13 -1: clearProperty
-18 -1: ForEachMappingTask
-15 -1: Collection.java
-55 -1: (Ljava/io/InputStream;)Ljava/security/cert/Certificate;
-5 -1: UTF-8
-11 -1: transitions
-7 -1: wrapAlt
-27 -1: ClassNotFoundException.java
-20 -1: UnresolvedPermission
-14 -1: charsetForName
-9 -1: getParent
-18 -1: [Ljava/lang/Short;
-24 -1: UnmodifiableNavigableMap
-5 -1: xflow
-10 -1: interfaces
-19 -1: doubleToRawLongBits
-73 -1: (Ljava/lang/reflect/Constructor<*>;[Ljava/lang/Object;)Ljava/lang/Object;
-10 -1: getInCheck
-21 -1: (Ljava/lang/Thread;)V
-15 -1: fromIndex < 0: 
-63 -1: (ITK;TV;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-9 -1: pollFirst
-21 -1: (Ljava/lang/Thread;)Z
-16 -1: checkProxyMethod
-39 -1: generateLambdaFormInterpreterEntryPoint
-15 -1: findLoadedClass
-6 -1: system
-5 -1: ITALY
-45 -1: combiner      SubjectDomainCombiner debugging
-34 -1: NativeConstructorAccessorImpl.java
-22 -1: ([C)Ljava/lang/String;
-39 -1: (Ljava/lang/String;Ljava/lang/Class;Z)V
-18 -1: java/lang/Thread$1
-20 -1: window can't be null
-10 -1: Debug.java
-17 -1: singletonIterator
-53 -1: java/util/concurrent/ConcurrentHashMap$ForEachKeyTask
-20 -1: java/security/Policy
-13 -1: getDescriptor
-32 -1: (I)Ljava/lang/invoke/MethodType;
-15 -1: nativeLibraries
-27 -1: sun/util/locale/LanguageTag
-8 -1: priority
-12 -1: IntegerCache
-14 -1: connectTimeout
-9 -1: namePairs
-17 -1: vmAllowSuspension
-16 -1: METHOD_MODIFIERS
-51 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-20 -1: MIN_TREEIFY_CAPACITY
-13 -1: getEntryBytes
-33 -1: ()Lsun/reflect/ReflectionFactory;
-17 -1: getDisplayCountry
-13 -1: isWrapperType
-5 -1: utf16
-12 -1: parallelSort
-27 -1: (Ljava/nio/ByteBuffer;IIZ)V
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;ILjava/lang/Class;I)Z
-9 -1: isDefined
-20 -1: sun/misc/FloatConsts
-10 -1: putDoubleB
-30 -1: java/lang/NoSuchFieldException
-27 -1: Value out of range. Value:"
-36 -1: sun/reflect/NativeMethodAccessorImpl
-7 -1: decoder
-38 -1: ([Ljava/lang/invoke/MutableCallSite;)V
-10 -1: putDoubleL
-68 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/generics/scope/MethodScope;
-37 -1: java/lang/invoke/MethodHandles$Lookup
-9 -1: Void.java
-28 -1: sun/util/locale/BaseLocale$1
-10 -1: stackTrace
-7 -1: toClass
-11 -1: access$1500
-41 -1: (Ljava/lang/Object;I)Ljava/lang/Class<*>;
-148 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/Object;JLjava/lang/invoke/DirectMethodHandle$1;)V
-22 -1: ARRAY_BYTE_BASE_OFFSET
-13 -1: ZipEntry.java
-56 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List;
-5 -1: utf32
-16 -1: ISO_646.irv:1991
-5 -1: p-126
-20 -1: sun.net.www.protocol
-3 -1: key
-20 -1: IMPLEMENTATION_TITLE
-93 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Lsun/util/locale/LanguageTag;
-66 -1: ([Ljava/lang/Object;[Ljava/lang/Object;IIILjava/util/Comparator;)V
-27 -1: java/nio/DirectFloatBufferS
-27 -1: java/nio/DirectFloatBufferU
-15 -1: JZENTRY_COMMENT
-8 -1: casTabAt
-10 -1: getVariant
-24 -1: Ljava/lang/Thread$State;
-35 -1: ()Ljava/lang/AbstractStringBuilder;
-114 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;Ljava/lang/ClassLoader;[Ljava/security/Principal;)V
-16 -1: getShortVolatile
-18 -1: SoftReference.java
-3 -1: BST
-12 -1: isCastableTo
-28 -1: sun.zip.disableMemoryMapping
-11 -1: copyOfRange
-17 -1: ()Lsun/misc/Perf;
-59 -1: (Ljava/lang/String;[Ljava/io/File;Ljava/lang/ClassLoader;)V
-27 -1: (Lsun/misc/JavaAWTAccess;)V
-8 -1: DECLARED
-18 -1: loadedLibraryNames
-6 -1: CENNAM
-7 -1: encprop
-5 -1: ABASE
-27 -1: java/util/WeakHashMap$Entry
-13 -1: wrapWithPrims
-5 -1: UTF32
-29 -1: Ljava/net/URISyntaxException;
-6 -1: groups
-65 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<+TT;>;)Ljava/util/Set<TT;>;
-32 -1: lambda$comparingByKey$6d558cbf$1
-15 -1: removeElementAt
-49 -1: [Ljava/util/concurrent/ConcurrentHashMap$Segment;
-32 -1: Sign character in wrong position
-6 -1: IBM819
-39 -1: java/security/cert/CertificateException
-4 -1: join
-30 -1: Ljava/lang/invoke/ForceInline;
-14 -1: expandCapacity
-19 -1: Ljava/lang/Integer;
-11 -1: NUMBER_THAI
-10 -1: getExtURLs
-9 -1: retainAll
-21 -1: (S)Ljava/lang/String;
-8 -1: truncate
-51 -1: java/util/ArraysParallelSortHelpers$FJObject$Sorter
-28 -1: newIndexOutOfBoundsException
-26 -1: JavaUtilJarAccessImpl.java
-22 -1: (II)Ljava/util/BitSet;
-10 -1: getLongAt0
-65 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)TA;
-26 -1: (Ljava/lang/ThreadLocal;)I
-5 -1: (J)[B
-27 -1: Ljava/lang/CharacterData00;
-18 -1: sun/misc/Cleaner$1
-59 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/util/Comparator;)I
-114 -1: (JLjava/util/function/ToDoubleFunction<Ljava/util/Map$Entry<TK;TV;>;>;DLjava/util/function/DoubleBinaryOperator;)D
-28 -1: java/lang/ClassCastException
-26 -1: (Ljava/lang/ThreadLocal;)V
-27 -1: ()[Ljava/lang/reflect/Type;
-13 -1: not invoker: 
-56 -1: (Ljava/net/URL;Ljava/net/Proxy;)Ljava/net/URLConnection;
-6 -1: before
-37 -1: ([DII)Ljava/util/stream/DoubleStream;
-9 -1: logicalOr
-9 -1: IS_METHOD
-12 -1: SPACE_USABLE
-12 -1: lastModified
-10 -1: setSigners
-8 -1: Invokers
-7 -1: nCopies
-12 -1: utf-32le-bom
-7 -1: (IIII)J
-17 -1: jdkSpecialVersion
-26 -1: ()Ljava/lang/StringBuffer;
-17 -1: SearchEntriesTask
-14 -1: java/net/Parts
-20 -1: Ljava/lang/Runnable;
-35 -1: java/util/WeakHashMap$ValueIterator
-19 -1: FinalReference.java
-7 -1: (IIII)V
-23 -1: Ljava/lang/ThreadGroup;
-10 -1: nullsFirst
-8 -1: setCache
-55 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/lang/Object;)Z
-24 -1: java/util/SimpleTimeZone
-6 -1: IBM850
-6 -1: IBM852
-25 -1: sun/net/www/MeteredStream
-4 -1: exts
-6 -1: IBM855
-16 -1: allocateElements
-6 -1: IBM857
-19 -1: setDefaultUseCaches
-6 -1: IBM858
-5 -1: slice
-9 -1: marklimit
-77 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Void;>;
-32 -1: java/util/Collections$CheckedSet
-12 -1: getModifiers
-8 -1: protocol
-10 -1: getInteger
-33 -1: ([J)Ljava/util/stream/LongStream;
-6 -1: IBM862
-8 -1: Map.java
-35 -1: java/lang/Class$EnclosingMethodInfo
-25 -1: (J)Ljava/math/BigInteger;
-31 -1: (Ljava/net/URL;Ljava/io/File;)V
-6 -1: IBM866
-6 -1: unload
-28 -1: sun/invoke/util/VerifyAccess
-105 -1: ()Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-25 -1: Resetting to invalid mark
-20 -1: java/util/Vector$Itr
-5 -1: SHIFT
-11 -1: NonfairSync
-18 -1: getSecurityManager
-34 -1: ()[Ljava/lang/ClassValue$Entry<*>;
-28 -1: (J)Ljava/lang/StringBuilder;
-28 -1: (Ljava/security/PublicKey;)V
-12 -1: getResources
-6 -1: IBM874
-27 -1:  which Java does not define
-36 -1: (Ljava/lang/invoke/MethodTypeForm;)V
-48 -1: array length is not legal for long[] or double[]
-18 -1: IS_FIELD_OR_METHOD
-7 -1: Aliases
-17 -1: checkedExceptions
-13 -1: getDayOfMonth
-51 -1: (Ljava/util/Spliterator;Z)Ljava/util/stream/Stream;
-20 -1: java/io/EOFException
-26 -1: Enclosing method not found
-17 -1: flushLeftoverChar
-122 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<*>;
-18 -1: buildAnnotatedType
-21 -1: setContextClassLoader
-22 -1: java/io/UnixFileSystem
-20 -1: nonSyncContentEquals
-43 -1: java/util/Collections$SynchronizedSortedMap
-15 -1: Properties.java
-35 -1: com.oracle.usagetracker.config.file
-13 -1: java/util/Map
-18 -1: setEagerValidation
-13 -1: getSetMessage
-6 -1: unlock
-14 -1: refKindIsField
-22 -1: bad field type alias: 
-17 -1: casAnnotationData
-6 -1: AUGUST
-106 -1: (Ljava/util/concurrent/CountedCompleter;[Ljava/lang/Object;[Ljava/lang/Object;IIIILjava/util/Comparator;)V
-11 -1: monitorExit
-17 -1: linkMethodTracing
-69 -1: (Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
-21 -1: java/lang/ClassLoader
-39 -1:               PKCS11 KeyStore debugging
-10 -1: checkRtype
-25 -1: getLocalGregorianCalendar
-23 -1: GenericDeclaration.java
-12 -1: isViewableAs
-22 -1: static_oop_field_count
-72 -1: (Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-11 -1: languageKey
-6 -1: Class 
-34 -1: java/util/HashMap$ValueSpliterator
-37 -1: (IJ)Ljava/lang/AbstractStringBuilder;
-17 -1: privilegedContext
-36 -1: java/util/LinkedHashMap$LinkedValues
-11 -1: getHostName
-10 -1: beginEntry
-7 -1: isAlpha
-61 -1: (Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/LambdaForm;
-10 -1: expandArgs
-14 -1: Finalizer.java
-14 -1: timeDefinition
-28 -1: ()Ljava/util/jar/Attributes;
-14 -1: ansi_x3.4-1968
-11 -1: setPriority
-23 -1: (C)Ljava/lang/Class<*>;
-26 -1: (Ljava/lang/Object;TV;)TV;
-70 -1: (Ljava/util/function/BiFunction;Ljava/lang/Object;Ljava/lang/Object;)V
-48 -1: ()Lsun/reflect/generics/factory/GenericsFactory;
-25 -1: java/lang/invoke/CallSite
-8 -1: tzdb.dat
-17 -1: containsAllLimits
-17 -1: fileNameMapLoaded
-6 -1: values
-17 -1: setLastAccessTime
-12 -1: expandFromVM
-50 -1: java/lang/invoke/MethodHandle$PolymorphicSignature
-3 -1: .EC
-14 -1: access denied 
-22 -1: java/util/AbstractList
-47 -1: (IILjava/lang/String;)Ljava/lang/StringBuilder;
-52 -1: ()Lsun/reflect/generics/repository/MethodRepository;
-22 -1: (Ljava/lang/String;)[B
-57 -1: (Ljava/lang/Object;)Ljava/lang/invoke/DirectMethodHandle;
-18 -1: compareAndSwapLong
-4 -1:  != 
-6 -1: StdArg
-29 -1: (Ljava/security/Permission;)V
-22 -1: ([D)Ljava/lang/String;
-28 -1: Lsun/reflect/MethodAccessor;
-14 -1: ansi_x3.4-1986
-20 -1: getPeakFinalRefCount
-29 -1: (Ljava/security/Permission;)Z
-5 -1: debug
-38 -1: (Ljava/lang/reflect/Constructor<*>;)[B
-27 -1: java/util/GregorianCalendar
-16 -1: Null replacement
-26 -1: ()Ljava/lang/reflect/Type;
-28 -1: DIRECTIONALITY_LEFT_TO_RIGHT
-102 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
-15 -1: isConvertibleTo
-24 -1: ARRAY_DOUBLE_INDEX_SCALE
-16 -1: getComponentType
-29 -1: sun/util/locale/LocaleMatcher
-11 -1: LOCALECACHE
-6 -1: UNWRAP
-16 -1: AbstractSet.java
-3 -1: CAT
-36 -1: java/lang/annotation/RetentionPolicy
-14 -1: getParameters0
-8 -1: .Handler
-33 -1: Ljava/lang/IllegalStateException;
-10 -1: RAW_RETURN
-20 -1: java/lang/ClassValue
-16 -1: getDisplayString
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-67 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/Map<TK;TV;>;
-214 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-33 -1: java/lang/invoke/SerializedLambda
-42 -1: ([Ljava/lang/Object;II)[Ljava/lang/Object;
-22 -1: java/util/zip/ZipUtils
-9 -1: setDaemon
-26 -1: java/net/HttpURLConnection
-6 -1: mkdirs
-20 -1: (Ljava/io/Reader;I)V
-28 -1: (IC)Ljava/lang/StringBuffer;
-45 -1: ([Ljava/lang/Class<*>;I)[Ljava/lang/Class<*>;
-29 -1: java/lang/invoke/MethodHandle
-28 -1: sun/misc/CompoundEnumeration
-6 -1: setVal
-23 -1: INTERNED_ARGUMENT_LIMIT
-4 -1: NULL
-49 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Z
-43 -1: java/util/Collections$UnmodifiableSortedMap
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)I
-6 -1: ([JJ)I
-19 -1: java/io/PrintWriter
-25 -1: ()Ljava/lang/ThreadGroup;
-5 -1: (IJ)J
-16 -1: onMalformedInput
-15 -1: decrementAndGet
-11 -1: -2147483648
-6 -1: reduce
-12 -1: asCharBuffer
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)V
-44 -1: (Ljava/util/SortedSet;)Ljava/util/SortedSet;
-9 -1: backtrace
-3 3: Bar
-47 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess;
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)Z
-5 -1: (IJ)V
-6 -1: ([JJ)V
-22 -1: ([Ljava/lang/Thread;)I
-5 -1: (IJ)Z
-7 -1: ([BII)I
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
-12 -1: getUnchecked
-10 -1: getBaseURL
-36 -1: (Ljava/lang/Object;)Ljava/util/List;
-53 -1: (Ljava/util/function/Function;)Ljava/util/Comparator;
-10 -1: getComment
-7 -1: ([BII)V
-30 -1: privateGetDeclaredConstructors
-58 -1: (Ljava/lang/String;ZILjava/util/Locale;)Ljava/lang/String;
-18 -1: unknown era name: 
-13 -1: invokeSpecial
-9 -1: checkLink
-16 -1: cspc8codepage437
-6 -1: stream
-18 -1: sun/nio/cs/UTF_8$1
-18 -1: contextClassLoader
-50 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)V
-30 -1: sun/util/calendar/BaseCalendar
-11 -1: enumeration
-18 -1: key can't be empty
-137 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-10 -1: getBoolean
-5 -1: eetop
-49 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/String;
-43 -1: sun/reflect/generics/scope/ConstructorScope
-13 -1: CANADA_FRENCH
-39 -1: Ljava/nio/channels/ReadableByteChannel;
-15 -1: java/lang/Float
-29 -1: DIRECTIONALITY_OTHER_NEUTRALS
-52 -1: (ZLjava/nio/charset/Charset;Ljava/io/OutputStream;)V
-8 -1: appendTo
-19 -1: PARAGRAPH_SEPARATOR
-16 -1: (Unknown Source)
-4 -1: tree
-38 -1: (I[C)Ljava/lang/AbstractStringBuilder;
-14 -1: VerifierStream
-48 -1: (Ljava/util/Collection<TE;>;Ljava/lang/Object;)V
-15 -1: releaseInflater
-20 -1: getHeaderNamesInList
-17 -1: getSystemPackages
-8 -1: teardown
-6 -1: (BZI)I
-10 -1: checkWrite
-19 -1: JavaLangAccess.java
-31 -1: Ljava/lang/ClassValue$Identity;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[S[SIIII)V
-24 -1: getDeclaredConstructors0
-3 -1: /..
-3 -1: /./
-16 -1: hashCodeForCache
-18 -1: Property settings:
-26 -1: Illegal initial capacity: 
-10 -1: text/plain
-61 -1: (Ljava/util/function/ToDoubleFunction;)Ljava/util/Comparator;
-24 -1: createMemoryManagerMBean
-10 -1: ,lastRule=
-9 -1: GMT-00:00
-5 -1: mtime
-40 -1: (Ljava/lang/String;I)[Ljava/lang/String;
-11 -1: (TT;TV;)TV;
-154 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
-41 -1: (Ljava/util/jar/JarFile;)Ljava/util/List;
-43 -1: (JILjava/lang/Object;)Ljava/nio/ByteBuffer;
-19 -1: MethodTypeForm.java
-21 -1: java/util/jar/JarFile
-30 -1: java/lang/Integer$IntegerCache
-22 -1: getDisplayVariantArray
-6 -1: setAll
-13 -1: ClassValueMap
-52 -1: (Ljava/security/PublicKey;Ljava/security/Provider;)V
-51 -1: java/util/concurrent/ConcurrentHashMap$BaseIterator
-59 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)V
-100 -1: (Ljava/util/concurrent/ConcurrentMap;Ljava/util/function/BiFunction;)Ljava/util/function/BiConsumer;
-8 -1: default 
-13 -1: compareAndSet
-10 -1: iso8859-13
-9 -1: putShortB
-14 -1: skipDelimiters
-28 -1: URI has a fragment component
-10 -1: iso8859-15
-42 -1: (Ljava/net/Proxy;)Ljava/net/URLConnection;
-23 -1: needsPackageAccessCheck
-9 -1: putShortL
-3 -1: //[
-69 -1: (Ljava/security/AccessControlContext;Ljava/security/DomainCombiner;)V
-18 -1: too many arguments
-35 -1: ([III)Ljava/util/Spliterator$OfInt;
-10 -1: CopiesList
-10 -1: iso-8859-1
-9 -1: ([BII[C)I
-10 -1: iso-8859-2
-11 -1: returnCount
-10 -1: iso-8859-4
-10 -1: iso-8859-5
-8 -1: utf_16be
-10 -1: iso-8859-7
-9 -1: isLimited
-9 -1: parseByte
-10 -1: iso-8859-9
-13 -1: , s.length() 
-10 -1: matchCerts
-14 -1: RECURSIVE_CHAR
-11 -1: reduceToInt
-11 -1: displayName
-9 -1: calendars
-64 -1: (Ljava/lang/String;ZLjava/util/jar/JarEntry;)Lsun/misc/Resource;
-11 -1: isProtected
-78 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/SortedMap;
-4 -1: trim
-20 -1: java/nio/FloatBuffer
-17 -1: PreHashedMap.java
-74 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Ljava/lang/String;>;
-22 -1: ([S)Ljava/lang/String;
-19 -1: PrintStreamOrWriter
-38 -1: java/util/Collections$EmptyEnumeration
-22 -1: java/util/LinkedList$1
-13 -1: sunpkcs11.jar
-25 -1: java/nio/DirectByteBuffer
-96 -1: (ZLjava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-7 -1: isArray
-43 -1: (Ljava/lang/String;)Ljava/util/Enumeration;
-52 -1: java/lang/invoke/MethodHandleImpl$AsVarargsCollector
-59 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class<*>;
-26 -1: setJavaNetHttpCookieAccess
-15 -1: wrongTargetType
-57 -1: java/util/concurrent/ConcurrentHashMap$ForEachMappingTask
-33 -1: [Ljava/lang/reflect/TypeVariable;
-5 -1: load0
-39 -1: (Ljava/lang/String;)Ljava/lang/Boolean;
-21 -1: isHeldByCurrentThread
-14 -1: outOfBoundsMsg
-30 -1: Ljava/lang/ref/Reference$Lock;
-11 -1: ISO-8859-13
-84 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-11 -1: ISO-8859-15
-40 -1: (Ljava/net/URL;)Ljava/net/URLConnection;
-84 -1: <T:Ljava/lang/Object;:Ljava/lang/Comparable<-TT;>;>(Ljava/util/Collection<+TT;>;)TT;
-38 -1: sun/reflect/generics/scope/MethodScope
-5 -1: mutex
-11 -1: loaderTypes
-8 -1: defaults
-22 -1: getActualTypeArguments
-41 -1: DIRECTIONALITY_EUROPEAN_NUMBER_TERMINATOR
-4 -1: keys
-71 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-94 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MethodHandle;
-113 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-12 -1: checkConnect
-39 -1: (Ljava/lang/String;Ljava/util/Locale;)V
-26 -1: ([CII[C)Ljava/lang/String;
-12 -1: isDoubleWord
-37 -1: configparser  JAAS ConfigFile parsing
-27 -1: sun/misc/Perf$GetPerfAction
-44 -1: (Ljava/util/Collections$UnmodifiableList;I)V
-4 -1: acos
-26 -1: java/nio/DirectLongBufferS
-7 -1: (ITE;)V
-14 -1: putIntVolatile
-24 -1: setContentHandlerFactory
-26 -1: java/nio/DirectLongBufferU
-10 -1: fieldCount
-11 -1: invokeBasic
-50 -1: (Ljava/util/zip/ZipEntry;)Ljava/util/jar/JarEntry;
-24 -1: java/util/Locale$Builder
-9 -1: setParent
-11 -1: asLifoQueue
-33 -1: lambda$comparingDouble$8dcf42ea$1
-24 -1: (Ljava/lang/Throwable;)I
-35 -1: (Lsun/misc/JavaUtilZipFileAccess;)V
-49 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode;
-10 -1: CLASS_PATH
-6 -1: tclass
-11 -1: getExponent
-23 -1: getAnnotatedReturnType0
-18 -1: checkPackageAccess
-35 -1: Can not instantiate java.lang.Class
-24 -1: (Ljava/lang/Throwable;)V
-195 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
-17 -1: Empty replacement
-3 -1: .SF
-14 -1: ByteOrder.java
-39 -1: ()Lsun/util/calendar/BaseCalendar$Date;
-35 -1: ()[Ljava/security/ProtectionDomain;
-12 -1: setElementAt
-30 -1: (Ljava/security/CodeSource;Z)Z
-45 -1: (Ljava/lang/Class<*>;)Ljava/lang/ClassLoader;
-52 -1: (Ljava/nio/charset/Charset;)Ljava/util/zip/ZipCoder;
-13 -1: foldArguments
-23 -1: java/time/LocalDateTime
-30 -1: [Lsun/launcher/LauncherHelper;
-16 -1: 0123456789abcdef
-60 -1: (Ljava/util/Spliterator$OfInt;Z)Ljava/util/stream/IntStream;
-33 -1: (ILjava/lang/String;IIIIIIIIIII)V
-20 -1: DMH.newInvokeSpecial
-28 -1: java/nio/charset/CoderResult
-33 -1: sun/nio/cs/StandardCharsets$Cache
-11 -1: saveConvert
-14 -1: ExtClassLoader
-12 -1: parentOrNull
-20 -1: insertParameterTypes
-32 -1: (II)Ljava/util/stream/IntStream;
-13 -1: setStackTrace
-20 -1:  is not an enum type
-3 -1: CNT
-4 -1: host
-85 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)Ljava/util/function/IntConsumer;
-11 -1: batchRemove
-8 -1: newField
-16 5: sun/nio/cs/UTF_8
-104 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
-8 -1: saturday
-35 -1: java/util/ArraysParallelSortHelpers
-15 -1: java/util/Queue
-40 -1: (Ljava/lang/Class<*>;)Ljava/lang/String;
-7 -1: toChars
-5 -1: first
-17 -1: ArrayDecoder.java
-30 -1: ()Lsun/reflect/MethodAccessor;
-26 -1: thread group can't be null
-13 -1: IllegalName: 
-32 -1: java/util/Collections$SetFromMap
-14 -1: line.separator
-17 -1: getDeclaredMethod
-10 -1: getMinutes
-35 -1: (Lsun/util/locale/BaseLocale$Key;)I
-40 -1: ([Ljava/lang/String;)Ljava/lang/Process;
-31 -1: Ljava/util/LinkedHashMap$Entry;
-13 -1: , str.length 
-8 -1: getProbe
-6 -1: ([DI)I
-5 -1: (CI)I
-23 -1: saveAndRemoveProperties
-6 -1: rehash
-3 -1: lcb
-31 -1: Ljava/util/Arrays$NaturalOrder;
-55 -1: (IILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
-10 -1: loadFactor
-15 -1: putLongVolatile
-34 -1: sun/misc/URLClassPath$FileLoader$1
-12 -1: Europe/Paris
-8 -1: DECEMBER
-86 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Launcher$AppClassLoader;>;
-22 -1: getImplMethodSignature
-38 -1: Malformed enclosing method information
-8 -1: maskNull
-3 -1: lct
-21 -1: CONSTRUCTOR_MODIFIERS
-36 -1: ()Lsun/misc/JavaNetHttpCookieAccess;
-12 -1: HashIterator
-84 -1: (Ljava/lang/Class;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
-33 -1: java/lang/Character$UnicodeScript
-5 -1: toHex
-27 -1: java/security/AllPermission
-17 -1: appendReplacement
-20 -1: SimpleImmutableEntry
-18 -1: getRequestProperty
-12 -1: compareCerts
-44 -1: java/util/ArrayPrefixHelpers$IntCumulateTask
-19 -1: makeSpreadArguments
-222 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-8 -1: addFirst
-6 -1: nextUp
-35 -1: (Ljava/net/ContentHandlerFactory;)V
-40 -1: (Ljava/lang/String;)Ljava/lang/Class<*>;
-23 -1: java/util/LocaleISOData
-14 -1: PREPARED_FORMS
-6 -1: FJByte
-20 -1: getGenericSuperclass
-6 -1: offset
-16 -1: LocaleUtils.java
-12 -1: isUnresolved
-18 -1: aliases_ISO_8859_1
-18 -1: aliases_ISO_8859_2
-15 -1: isSurrogatePair
-18 -1: aliases_ISO_8859_4
-18 -1: aliases_ISO_8859_5
-6 -1: EXTLEN
-18 -1: aliases_ISO_8859_7
-15 -1: Comparator.java
-18 -1: aliases_ISO_8859_9
-15 -1: ISO_8859-2:1987
-22 -1: Ljava/util/List<+TE;>;
-16 -1: Unknown Category
-3 -1: CST
-51 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;
-6 -1: FRIDAY
-40 -1: (Ljava/lang/String;ZZ)Ljava/lang/String;
-13 -1: isInterrupted
-8 -1: utf_16le
-89 -1: (BLjava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-22 -1: checkInvocationCounter
-12 -1: EPOCH_OFFSET
-35 -1: (JJILjava/nio/DirectByteBuffer$1;)V
-7 -1: canRead
-9 -1: getLoader
-18 -1: publicConstructors
-23 -1: factory already defined
-33 -1: java/lang/ref/ReferenceQueue$Null
-37 -1: (Ljava/util/List;Ljava/util/Random;)V
-25 -1: setPackageAssertionStatus
-20 -1: MapReduceEntriesTask
-11 -1: OPEN_DELETE
-35 -1: (Ljava/util/Set;Ljava/lang/Class;)V
-9 -1: rootGroup
-10 -1: updateForm
-22 -1: JavaUtilJarAccess.java
-3 -1: CTT
-57 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Constructor;
-82 -1: <T:Ljava/lang/Object;>(Ljava/util/NavigableSet<TT;>;)Ljava/util/NavigableSet<TT;>;
-13 -1: getReturnType
-34 -1: java/util/HashMap$EntrySpliterator
-14 -1: TIME_UNDEFINED
-32 -1: com/sun/crypto/provider/AESCrypt
-7 -1: H_DIGIT
-20 -1: clearAssertionStatus
-44 -1: java/lang/invoke/MethodHandleImpl$BindCaller
-8 -1: scloader
-6 -1: IBM923
-5 -1: read0
-5 -1: read1
-4 -1: true
-9 -1: BA_HIDDEN
-16 -1: jvmUpdateVersion
-36 -1: java/lang/StringCoding$StringDecoder
-37 -1: (J)Ljava/nio/file/attribute/FileTime;
-3 -1: lib
-17 -1: getParameterTypes
-15 -1: FinalizerThread
-31 -1: ()Lsun/util/calendar/Gregorian;
-50 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuffer;
-13 -1: PROP_SETTINGS
-33 -1: java/util/function/BinaryOperator
-70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-25 -1: getDefaultRequestProperty
-27 -1: (Ljava/util/jar/JarEntry;)V
-27 -1: SPLITERATOR_CHARACTERISTICS
-18 -1: FieldAccessor.java
-10 -1: setComment
-62 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMXBean;
-11 -1: array_klass
-39 -1: ()Ljava/lang/Class$EnclosingMethodInfo;
-67 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;)I
-9 -1: (II[CII)I
-50 -1: (Ljava/util/jar/JarFile;Ljava/util/zip/ZipEntry;)V
-20 -1: SPECIFICATION_VENDOR
-72 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)Ljava/util/jar/JarFile;
-87 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;TT;)V
-9 -1: isVarArgs
-10 -1: setBoolean
-12 -1: (TK;TV;TV;)Z
-16 -1: findSharedClass0
-5 -1: csize
-49 -1: Ljava/security/cert/CertificateEncodingException;
-40 -1: java/util/concurrent/locks/ReentrantLock
-86 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamEncoder;
-5 -1: ready
-38 -1: Ljava/security/AccessControlException;
-28 -1: UnmodifiableRandomAccessList
-69 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/BinaryOperator<TT;>;)V
-27 -1: Ljava/lang/invoke/Invokers;
-39 -1: java/util/LinkedList$DescendingIterator
-11 -1: writeFields
-17 -1: classLoaderDepth0
-18 -1: permutedTypesMatch
-52 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
-12 -1: linkToStatic
-10 -1: CheckedMap
-6 -1: CENOFF
-8 -1: lastRule
-15 -1: java/lang/Short
-39 -1: ()Ljava/lang/Class$ReflectionData<TT;>;
-8 -1: nextDown
-14 -1: image/x-pixmap
-39 -1: (Ljava/lang/Class;[Ljava/lang/Object;)V
-25 -1: defineClassSourceLocation
-23 -1: sun/misc/PostVMInitHook
-15 -1: could not load 
-16 -1: allowArraySyntax
-90 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<Ljava/io/BufferedInputStream;[B>;
-10 -1: putBoolean
-11 -1:  has params
-14 -1: setMaxPriority
-10 -1: mayContain
-46 -1: java/lang/reflect/MalformedParametersException
-10 -1: baseLocale
-14 -1: isSubwordOrInt
-10 -1: nextDouble
-32 -1: java/lang/Character$UnicodeBlock
-85 -1: (JLjava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)D
-20 -1: numberOfLeadingZeros
-59 -1: (I[Ljava/lang/Class<*>;)[Ljava/lang/invoke/LambdaForm$Name;
-7 -1: setSize
-29 -1: java/io/FileNotFoundException
-9 -1: getString
-24 -1: ([CII)Ljava/lang/String;
-38 -1: (Ljava/lang/String;Ljava/lang/Class;)V
-5 -1: shift
-18 -1: getConstructorSlot
-41 -1: java/lang/ThreadLocal$SuppliedThreadLocal
-16 -1: UNASSIGNED_STACK
-20 -1: Malformed class name
-12 -1: ofEpochMilli
-34 -1: sun/launcher/LauncherHelper$StdArg
-33 -1: java/nio/ByteBufferAsShortBufferB
-7 -1: convert
-21 -1: ()[Ljava/util/Locale;
-15 -1: ISO_8859-5:1988
-35 -1: av[0] not instace of MethodHandle: 
-33 -1: java/nio/ByteBufferAsShortBufferL
-5 -1: hypot
-16 -1: InputStream.java
-13 -1: reinvokerForm
-39 -1: JVMTI_THREAD_STATE_WAITING_INDEFINITELY
-16 -1: sun/misc/Version
-66 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)[TT;
-11 -1: codePointAt
-30 -1: ([Ljava/lang/reflect/Method;)V
-9 -1: duplicate
-9 -1: interface
-5 -1: X.509
-24 -1: SynchronizedNavigableSet
-8 -1: us-ascii
-17 -1: getUnresolvedType
-21 -1: PRIVATE_USE_EXTENSION
-4 -1: form
-93 -1: (Ljava/util/ArrayPrefixHelpers$LongCumulateTask;Ljava/util/function/LongBinaryOperator;[JII)V
-27 -1: sealing violation: package 
-34 -1: RuntimeVisibleParameterAnnotations
-17 -1: LF_INVSTATIC_INIT
-14 -1: Gregorian.java
-32 -1: java/util/function/UnaryOperator
-3 -1: log
-3 -1: low
-22 -1: sun/misc/JavaNetAccess
-9 -1: getLength
-21 -1: getRawTypeAnnotations
-36 -1: (Ljava/lang/String;)Ljava/lang/Long;
-9 -1: getNumber
-66 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node;
-20 -1: (Ljava/lang/Class;)C
-89 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map$Entry<TK;TV;>;
-6 -1: ENDSIG
-20 -1: (Ljava/lang/Class;)I
-20 -1: (Ljava/lang/Class;)J
-24 -1: [[Ljava/io/Serializable;
-22 -1: serialPersistentFields
-7 -1: console
-142 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-27 -1: (Ljava/nio/ByteBuffer;ICZ)V
-20 -1: (Ljava/lang/Class;)V
-40 -1: java/lang/ArrayIndexOutOfBoundsException
-6 -1: this$0
-51 -1: (Ljava/lang/invoke/MemberName;[Ljava/lang/Object;)V
-18 -1: packageAccessValid
-33 -1: ([Ljava/lang/StackTraceElement;)V
-8 -1: constant
-113 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
-8 -1: isMethod
-20 -1: (Ljava/lang/Class;)Z
-6 -1: ENDSIZ
-8 -1: newEntry
-57 -1: (Ljava/lang/Object;)Ljava/lang/IndexOutOfBoundsException;
-25 -1: (Ljava/util/Comparator;)V
-8 -1: isBridge
-6 -1: ([BI)I
-6 -1: ([BI)J
-16 -1: getReferenceKind
-26 -1: [Ljava/security/Principal;
-71 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-32 -1: ()Ljava/lang/ClassValue$Version;
-16 -1: SearchValuesTask
-17 -1: setCompressedSize
-16 -1: DEFAULT_CAPACITY
-108 -1: <K:Ljava/lang/Object;V::Ljava/lang/Comparable<-TV;>;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-27 -1: java/util/ComparableTimSort
-41 -1: null StackTraceElement in serial stream. 
-6 -1: ([BI)V
-44 -1: (Ljava/util/jar/JarFile;)Lsun/misc/JarIndex;
-71 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)Ljava/util/Enumeration;
-52 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Z
-36 -1: [Ljava/lang/reflect/TypeVariable<*>;
-17 -1: OutputStream.java
-8 -1: combiner
-15 -1: decodeArrayLoop
-19 -1: (Ljava/io/Writer;)V
-41 -1: (Ljava/util/List<*>;Ljava/util/List<*>;)I
-35 -1: ()[Ljava/security/cert/Certificate;
-33 -1: ([I)Ljava/util/Spliterator$OfInt;
-9 -1: NF_asType
-17 -1: java/io/Closeable
-11 -1: updateBytes
-12 -1: charsets.jar
-18 -1: getDeclaredFields0
-47 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Member;
-60 -1: (Ljava/lang/String;ILjava/lang/String;)Ljava/nio/ByteBuffer;
-15 -1: getTotalSeconds
-57 -1: (Ljava/util/Collection<+Ljava/util/Map$Entry<TK;TV;>;>;)Z
-4 -1: JULY
-10 -1: Exceptions
-41 -1: ()Ljava/util/List<Ljava/io/IOException;>;
-14 -1: ParseUtil.java
-13 -1: getJarFileURL
-29 -1: setJavaIOFileDescriptorAccess
-24 -1: ARRAY_OBJECT_BASE_OFFSET
-21 -1: onUnmappableCharacter
-53 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/util/Map;
-24 -1: MethodHandleNatives.java
-40 -1: java/nio/charset/MalformedInputException
-37 -1: [Ljava/lang/reflect/AnnotatedElement;
-15 -1: CLASSPATH_CHARS
-18 -1: [Ljava/lang/Class;
-7 -1: FJFloat
-47 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;I)V
-19 -1: Ljava/lang/Runtime;
-23 -1: java/lang/CharacterData
-42 -1: (Ljava/lang/Void;Ljava/lang/ClassLoader;)V
-76 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)V
-56 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;B)V
-19 -1: java/util/zip/CRC32
-33 -1: <T:Ljava/lang/Object;>([TT;I)[TT;
-22 -1: ([F)Ljava/lang/String;
-5 -1: UTF_8
-20 -1: aliases_UTF_32BE_BOM
-11 -1: Buffer.java
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<TT;>;)Ljava/util/Comparator<TT;>;
-44 -1: (Ljava/lang/String;)Ljava/util/zip/ZipEntry;
-9 -1: malformed
-4 -1: JUNE
-51 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarFile$1;)V
-6 -1: locale
-34 -1: (Ljava/util/function/BiFunction;)V
-10 -1: setMinutes
-40 -1: (Ljava/lang/reflect/AccessibleObject;Z)V
-12 -1: maybeCompile
-46 -1: (Ljava/lang/Class;Ljava/lang/reflect/Method;)V
-7 -1: getEras
-55 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Iterator<*>;)[TT;
-17 -1: toUnsignedString0
-32 -1: (Ljava/lang/invoke/MethodType;)V
-32 -1: (Ljava/lang/invoke/MethodType;)Z
-10 -1: Class.java
-27 -1: ()Ljava/util/Iterator<TK;>;
-29 -1: WINDOWS_EPOCH_IN_MICROSECONDS
-41 -1: (Ljava/io/InputStream;)Ljava/lang/String;
-4 -1: prev
-24 -1: ()Ljava/util/Properties;
-11 -1: awaitBooted
-19 -1: generateConstructor
-22 -1: sun/misc/SharedSecrets
-19 -1: getDateTimeInstance
-43 -1: (IIILsun/util/calendar/BaseCalendar$Date;)J
-5 -1: setID
-11 -1: Locale.java
-12 -1: getRootGroup
-15 -1: setLastModified
-7 -1: trouble
-28 -1: (Z)Ljava/lang/StringBuilder;
-5 -1: setIO
-17 -1: loadClassInternal
-23 -1: java/lang/ref/Finalizer
-8 -1: EmptySet
-16 -1: aliases_UTF_16BE
-50 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap;
-15 -1: unmodifiableMap
-48 -1: (Ljava/lang/Class<*>;)Lsun/reflect/ConstantPool;
-15 -1: arrayContentsEq
-7 -1: EXT_TAG
-31 -1: (Ljava/util/HashMap$TreeNode;)Z
-5 -1: cp737
-22 -1: java/util/zip/Checksum
-5 -1: names
-22 -1: ConcurrentHashMap.java
-7 -1: ([J[J)Z
-7 -1: WAITING
-31 -1: sun.launcher.resources.launcher
-14 -1: getThreadGroup
-8 -1: PutField
-12 -1: hugeCapacity
-9 -1: isPackage
-72 -1: (Ljava/lang/ThreadLocal<*>;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-23 7: sun/nio/ch/DirectBuffer
-13 -1: Checksum.java
-25 -1: (Ljava/nio/ByteBuffer;I)C
-51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/Object;
-25 -1: (Ljava/nio/ByteBuffer;I)D
-7 -1: treeify
-25 -1: (Ljava/nio/ByteBuffer;I)F
-5 -1: setIn
-25 -1: (Ljava/nio/ByteBuffer;I)I
-20 -1: TRACE_METHOD_LINKAGE
-25 -1: (Ljava/nio/ByteBuffer;I)J
-7 -1: putIntB
-22 -1: createGarbageCollector
-50 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;)[TT;
-25 -1: (Ljava/nio/ByteBuffer;I)S
-7 -1: putIntL
-19 -1: (B)Ljava/lang/Byte;
-14 -1: Hashtable.java
-29 -1: java/lang/ArrayStoreException
-11 -1: all_allowed
-16 -1: getLastRawOffset
-7 -1: inReady
-36 -1: java/lang/ThreadLocal$ThreadLocalMap
-40 -1: (ILjava/lang/String;Ljava/lang/String;)V
-23 -1: Ljava/lang/ThreadLocal;
-16 -1: classValueOrNull
-62 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
-23 -1: preparedFieldLambdaForm
-22 -1: (Z)Ljava/lang/Boolean;
-14 -1: ThreadLocalMap
-27 -1: java/lang/StackTraceElement
-13 -1: getEntryCSize
-19 -1: java.security.debug
-53 -1: (Ljava/util/Collection<*>;Ljava/util/Collection<*>;)Z
-6 -1: LOCLEN
-40 -1: Ljava/lang/Class<Ljava/lang/Character;>;
-6 -1: (JJB)V
-66 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/ContentHandler;>;
-31 -1: [[Ljava/lang/StackTraceElement;
-9 -1: putStatic
-16 -1: Asia/Ho_Chi_Minh
-15 -1: getDisplayNames
-13 -1: convertToAbbr
-23 -1: Method not implemented.
-15 -1: isCCLOverridden
-14 -1: doubleCapacity
-137 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-219 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-7 -1: native 
-29 -1: (Ljava/lang/reflect/Field;Z)V
-18 -1: Ljava/util/Locale;
-31 -1: Ljava/util/concurrent/TimeUnit;
-16 -1: threadsSuspended
-7 -1: ([III)V
-20 -1: setMaxDelimCodePoint
-18 -1: contentClassPrefix
-13 -1: mappingOffset
-10 -1: toIndex = 
-47 -1: (Ljava/lang/CharSequence;)Ljava/io/PrintStream;
-12 -1: booleanValue
-13 -1: putMapEntries
-17 -1: defaultBundleName
-50 -1: (Ljava/util/concurrent/CountedCompleter;[B[BIIII)V
-10 -1: executable
-20 -1: java/time/ZoneOffset
-28 -1: java/lang/ref/FinalReference
-11 -1: newTreeNode
-7 -1: lookup2
-10 -1: TableStack
-59 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView<TK;TV;>;
-11 -1: getAccessor
-9 -1: available
-18 -1: java/io/FileReader
-34 -1: java/security/ProtectionDomain$3$1
-16 -1: integer overflow
-11 -1: internTable
-28 -1: Ljava/util/HashMap$TreeNode;
-19 -1: | invocationCounter
-12 -1: findResource
-9 -1: isLoaded0
-5 -1: cp775
-24 -1: DIRECTIONALITY_UNDEFINED
-9 -1: isInvalid
-7 -1: lookupN
-35 -1: (Lsun/reflect/MethodAccessorImpl;)V
-6 -1: ENDSUB
-4 -1:  to 
-59 -1: ([Ljava/lang/Object;IILjava/lang/Class;)[Ljava/lang/Object;
-10 -1: meta-index
-6 -1: INDENT
-9 -1: WEDNESDAY
-40 -1: ()Ljava/lang/annotation/RetentionPolicy;
-14 -1: getUsableSpace
-7 -1: TUESDAY
-51 -1: (Ljava/lang/Class;I)Ljava/lang/invoke/MethodHandle;
-12 -1: getSubjectDN
-21 -1: Ljava/io/InputStream;
-25 -1: (IC)Ljava/nio/CharBuffer;
-52 -1: (Ljava/nio/CharBuffer;)Ljava/util/function/Supplier;
-17 -1: ()[Ljava/net/URL;
-6 -1: search
-10 -1: Main-Class
-8 -1: ([CIIC)I
-16 -1: Certificate.java
-14 -1: spreadInvokers
-22 -1: sun/nio/cs/ISO_8859_15
-6 -1: accept
-18 -1: ReflectAccess.java
-13 -1: java/nio/Bits
-14 -1: linkToCallSite
-46 -1: Ljava/nio/charset/UnsupportedCharsetException;
-8 -1: ([CIIC)V
-9 -1: (TT;TV;)V
-26 -1: java/lang/OutOfMemoryError
-34 -1: policy        loading and granting
-76 -1: (Ljava/nio/CharBuffer;ILjava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
-13 -1: x-windows-949
-21 -1: Ljava/io/PrintStream;
-9 -1: initNames
-12 -1: testAnyFlags
-65 -1: (Ljava/lang/reflect/Method;)Ljava/lang/invoke/DirectMethodHandle;
-34 -1: (Ljava/util/List;)Ljava/util/List;
-10 -1: CacheEntry
-10 -1: hasAllPerm
-26 -1: java/nio/charset/Charset$1
-26 -1: java/nio/charset/Charset$2
-19 -1: ()Ljava/util/Stack;
-26 -1: java/nio/charset/Charset$3
-62 -1: (Ljava/lang/String;)Lsun/util/calendar/LocalGregorianCalendar;
-23 -1: ARRAY_FLOAT_INDEX_SCALE
-23 -1: (Ljava/lang/Object;IS)V
-13 -1: x-windows-950
-31 -1: Ljava/util/Hashtable$Entry<**>;
-87 -1: Ljava/util/WeakHashMap<Ljava/lang/ClassValue$Identity;Ljava/lang/ClassValue$Entry<*>;>;
-9 -1: permClass
-37 -1: (Ljava/security/ProtectionDomain$3;)V
-99 -1: <S::Lsun/reflect/generics/tree/Signature;>Lsun/reflect/generics/repository/AbstractRepository<TS;>;
-37 -1: ()Ljava/util/function/BinaryOperator;
-64 -1: java/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap
-91 -1: (Ljava/util/ArrayPrefixHelpers$IntCumulateTask;Ljava/util/function/IntBinaryOperator;[III)V
-6 -1: getCrc
-25 -1: ByteArrayInputStream.java
-9 -1: SYNTHETIC
-52 -1: Ljava/lang/ref/PhantomReference<Ljava/lang/Object;>;
-246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-38 -1: java/lang/Throwable$WrappedPrintStream
-21 -1: Illegal load factor: 
-43 -1: Ljava/util/Deque<Ljava/util/zip/Inflater;>;
-3 -1: map
-6 -1: expand
-6 -1: access
-3 -1: max
-33 -1: impliesCreateAccessControlContext
-3 -1: may
-53 -1: java/util/concurrent/ConcurrentHashMap$ReduceKeysTask
-91 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/URLClassPath$Loader;>;
-60 -1: attempt to add a Permission to a readonly Permissions object
-21 -1: canonicalizeExtension
-11 -1: copyValueOf
-25 -1: (IJ)Ljava/nio/LongBuffer;
-112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-11 -1: DeqIterator
-11 -1: SpeciesData
-8 -1: getCause
-16 -1: aliases_UTF_16LE
-51 -1: (TT;TV;Ljava/util/function/BinaryOperator<TV;>;)TV;
-25 -1: (JF)Ljava/nio/ByteBuffer;
-16 -1: sun/misc/IOUtils
-32 -1: Ljava/util/Locale$FilteringMode;
-6 -1: .class
-13 -1: getPermission
-13 -1: startsWithLOC
-8 -1: Identity
-23 -1: ([BII)Ljava/lang/Class;
-15 -1: putByteVolatile
-36 -1: (Ljava/util/Deque;)Ljava/util/Queue;
-22 -1: (Ljava/lang/Object;S)V
-47 -1: java/util/concurrent/ConcurrentHashMap$BulkTask
-4 -1: n = 
-9 -1: (ITE;)TE;
-5 -1: zeroD
-18 -1: formatUnsignedLong
-29 -1:     default display locale = 
-23 -1: java/io/File$PathStatus
-5 -1: zeroF
-20 -1: Ljava/util/Set<TK;>;
-20 -1: (Ljava/util/List;I)V
-5 -1: zeroI
-5 -1: zeroJ
-7 -1: context
-39 -1: Ljava/nio/channels/WritableByteChannel;
-5 -1: zeroL
-34 -1: Lsun/util/calendar/CalendarSystem;
-24 -1: JVMTI_THREAD_STATE_ALIVE
-18 -1: (Ljava/util/Set;)V
-18 -1: (Ljava/util/Set;)Z
-42 -1: (TT;Ljava/lang/ref/ReferenceQueue<-TT;>;)V
-7 -1: entries
-30 -1: (Ljava/util/WeakHashMap;IIII)V
-15 -1: csisolatingreek
-38 -1: ([Ljava/lang/Class;)Ljava/lang/Object;
-12 -1: isMalformed3
-12 -1: isMalformed4
-5 -1: FJInt
-23 -1: java/util/LinkedHashMap
-20 -1: malformedInputAction
-12 -1: Charset.java
-5 -1: LLL_L
-42 -1: (Ljava/util/Collection;)Ljava/lang/Object;
-22 -1: makeMethodHandleInvoke
-3 -1: mdt
-7 -1: unicode
-12 -1: newInstance0
-10 -1: checkCerts
-34 -1: java/util/WeakHashMap$HashIterator
-23 -1: (Ljava/lang/Object;JI)I
-9 -1: hexDigits
-13 -1: javaToDosTime
-24 -1: (I)Ljava/nio/LongBuffer;
-6 -1: A_DATA
-12 -1: deepToString
-23 -1: (Ljava/lang/Object;JI)V
-91 -1: (JLjava/util/function/ToLongBiFunction<-TK;-TV;>;JLjava/util/function/LongBinaryOperator;)J
-23 -1: bad spread array length
-11 -1: readTimeout
-14 -1: toAbsolutePath
-8 -1: isFinite
-19 -1: currentLoadedClass0
-3 -1: \xef\xbf\xbd
-23 -1: (Ljava/nio/file/Path;)I
-8 -1: handlers
-21 -1: (Ljava/util/List;II)V
-89 -1: (Lsun/misc/URLClassPath$Loader;Ljava/lang/String;Ljava/net/URL;Ljava/net/URLConnection;)V
-8 -1: OVERFLOW
-8 -1: newTable
-8 -1: THURSDAY
-6 -1: notify
-12 -1: initialValue
-35 -1: (I)Ljava/util/LinkedList$Node<TE;>;
-18 -1: AsVarargsCollector
-26 -1: (Lsun/misc/JavaIOAccess;)V
-18 -1: ()Ljava/lang/Void;
-23 -1: (Ljava/nio/file/Path;)Z
-16 -1: MINUTE_IN_MILLIS
-67 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
-18 -1: Ljava/util/Vector;
-70 -1: (Ljava/lang/reflect/Constructor;[Ljava/lang/Object;)Ljava/lang/Object;
-40 -1: (Ljava/lang/Object;ILjava/lang/Object;)V
-25 -1: UnresolvedPermission.java
-14 -1: ReduceKeysTask
-21 -1: ()[Ljava/lang/Object;
-129 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
-16 -1: ClassLoader.java
-46 -1: Ljava/util/Comparators$NaturalOrderComparator;
-17 -1: compareAndSwapInt
-22 -1: packageDefinitionValid
-41 -1: ([Ljava/lang/Object;[Ljava/lang/Object;)Z
-162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/lang/String;>;
-16 -1: sun.zip.zipFiles
-17 -1: java_runtime_name
-31 -1: (Ljava/lang/ClassValue$Entry;)V
-31 -1: (Ljava/lang/ClassValue$Entry;)Z
-30 -1: <T:Ljava/lang/Object;>(TT;)TT;
-39 -1: JavaSecurityProtectionDomainAccess.java
-24 -1: (I)Ljava/lang/Throwable;
-7 -1: FJShort
-9 -1: putFloatB
-19 -1: checkedNavigableSet
-25 -1: java/lang/invoke/Invokers
-18 -1: setIfModifiedSince
-14 -1: parameterTypes
-41 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)V
-9 -1: putFloatL
-11 -1: getTypeCode
-5 -1: (ZZ)I
-24 -1: java/lang/ProcessBuilder
-9 -1: UNDERFLOW
-21 -1: VolatileCallSite.java
-24 -1: (C)Ljava/nio/CharBuffer;
-55 -1: java/util/concurrent/ConcurrentHashMap$ForEachValueTask
-26 -1: (Ljava/lang/String;[CII)[B
-18 -1: reduceKeysToDouble
-5 -1: (ZZ)Z
-23 -1: setCallSiteTargetNormal
-3 -1: min
-4 -1: ceil
-62 -1: (Ljava/lang/String;)Ljava/util/LinkedList<Ljava/lang/String;>;
-29 -1: (Ljava/util/AbstractList;II)V
-32 -1: Ljava/lang/Class$AnnotationData;
-21 -1: createFileExclusively
-64 -1: (Ljava/lang/ref/SoftReference;I)Ljava/lang/Class$ReflectionData;
-26 -1: java/lang/Short$ShortCache
-54 -1: (Ljava/net/URL;Ljava/io/File;)Ljava/net/URLConnection;
-29 -1: Lsun/nio/cs/Surrogate$Parser;
-58 -1: (Ljava/lang/Class;)Lsun/reflect/annotation/AnnotationType;
-8 -1: findForm
-53 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet;
-39 -1: (Lsun/misc/Perf;Ljava/nio/ByteBuffer;)V
-16 -1: mergePermissions
-11 -1: totalMemory
-53 -1: java/lang/invoke/DirectMethodHandle$EnsureInitialized
-139 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/concurrent/ConcurrentMap<TK;TV;>;Ljava/io/Serializable;
-29 -1: java/util/HashMap$KeyIterator
-20 -1: STACK_TRACE_SENTINEL
-5 -1: order
-18 -1: java/lang/Runnable
-8 -1: GetField
-13 -1: Empty command
-7 -1: CONTROL
-9 -1: blockedOn
-12 -1: testAllFlags
-11 -1: getInflater
-16 -1: threadTerminated
-44 -1: (Ljava/lang/ThreadGroup;Ljava/lang/String;)V
-20 -1: java.runtime.version
-8 -1: peekLast
-23 -1: java/util/ArrayList$Itr
-21 -1: (Ljava/util/Locale;)V
-13 -1: isOptimizable
-8 -1: FairSync
-7 -1: CHINESE
-15 -1: initHelpMessage
-30 -1: ()Ljava/util/HashMap$TreeNode;
-29 -1: Ljava/lang/SecurityException;
-7 -1: charset
-35 -1: sun/security/util/SecurityConstants
-19 -1: sun.nio.cs.bugLevel
-8 2: Foo.java
-49 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;)V
-12 -1: EntrySetView
-37 -1: (Lsun/misc/JavaNetHttpCookieAccess;)V
-35 -1: Ljava/util/Hashtable$Entry<TK;TV;>;
-20 -1: NF_constructorMethod
-8 -1: getMonth
-38 -1: (Ljava/util/Iterator;Ljava/util/Map;)V
-14 -1: getIntVolatile
-6 -1: [name=
-8 -1: oop_size
-20 -1: Can't load library: 
-30 -1: ()Ljava/util/Spliterator<TV;>;
-33 -1: Lsun/reflect/ConstructorAccessor;
-61 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Integer;>;
-15 -1: printVmSettings
-33 -1: stack         include stack trace
-45 -1: ([Ljava/lang/Object;I)Ljava/util/Spliterator;
-37 -1: sun/reflect/generics/scope/ClassScope
-36 -1: java/io/UnsupportedEncodingException
-24 -1: (J)Ljava/nio/LongBuffer;
-11 -1: addressSize
-15 -1: ByteBuffer.java
-62 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/ClassSignature;
-9 -1: (TT;TT;)I
-25 -1: java/io/DefaultFileSystem
-15 -1: BaseLocale.java
-14 -1: BitSetIterator
-17 -1: AbstractList.java
-57 -1: Ljava/lang/ref/WeakReference<Ljava/lang/ThreadLocal<*>;>;
-178 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-9 -1: arguments
-26 -1: java/util/Locale$LocaleKey
-9 -1: setLength
-29 -1: sun/nio/cs/ISO_8859_1$Decoder
-9 -1: zipfs.jar
-24 -1: Ljava/util/zip/ZipCoder;
-14 -1: , new state = 
-93 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJLjava/util/concurrent/ConcurrentHashMap;)V
-39 -1: java/security/PrivilegedExceptionAction
-9 -1: dnsns.jar
-20 -1: iteratorBinarySearch
-14 -1: initializePath
-22 -1: DefaultFileSystem.java
-17 -1: Ljava/util/Deque;
-8 -1: DEFLATED
-11 -1: Can't load 
-9 -1: ArrayList
-21 -1: negativeZeroFloatBits
-41 -1: (Ljava/lang/String;ILjava/util/Locale;)[C
-14 -1: ANSI_X3.4-1968
-39 -1: sun/reflect/annotation/AnnotationType$1
-3 -1: mod
-62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/ByteBuffer;>;
-29 -1: interpretWithArgumentsTracing
-6 -1: getDay
-47 -1: sun/reflect/generics/repository/ClassRepository
-19 -1: refKindDoesDispatch
-20 -1: getAnnotationsByType
-14 -1: needsExpansion
-18 -1: lastIndexOfSubList
-26 -1: JavaUtilZipFileAccess.java
-59 -1: (Ljava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
-12 -1: ptypesOffset
-8 -1: hashcode
-18 -1: ([Ljava/net/URL;)V
-8 -1: iso-ir-6
-7 -1: jzentry
-52 -1:               only dump output if specified codebase
-31 -1: lambda$comparingLong$6043328a$1
-5 -1: MARCH
-14 -1: ANSI_X3.4-1986
-14 -1: isMalformed3_2
-7 -1: IS_TYPE
-68 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/charset/Charset;>;
-30 -1: protocol doesn't support input
-17 -1: getExtClassLoader
-14 -1: setProxiedHost
-73 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-16 -1: traceInterpreter
-17 -1: (Ljava/net/URL;)I
-5 -1: expm1
-18 -1: createInheritedMap
-66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedEntryTask
-17 -1: getTimeOfDayValue
-15 -1: zeroLengthArray
-20 -1: invalid permission: 
-6 -1: REPORT
-15 -1: isNumericString
-78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
-6 -1: (TV;)Z
-25 -1: Lsun/misc/JavaLangAccess;
-29 -1: (I)Ljava/lang/reflect/Method;
-17 -1: (Ljava/net/URL;)V
-34 -1: ()Ljava/lang/Class$ReflectionData;
-50 -1: java.lang.invoke.MethodHandle.TRACE_METHOD_LINKAGE
-10 -1: copyWith: 
-17 -1: (Ljava/net/URL;)Z
-32 -1: ()Ljava/util/stream/Stream<TE;>;
-22 -1: quickCheckMemberAccess
-29 -1: ()Lsun/net/www/MessageHeader;
-19 -1: getAssignedCombiner
-8 -1: ([JIIJ)I
-17 -1: formatUnsignedInt
-68 -1: <V:Ljava/lang/Object;>Ljava/util/AbstractMap<Ljava/lang/String;TV;>;
-34 -1: java/nio/ByteBufferAsDoubleBufferB
-32 -1: ([I)Ljava/util/stream/IntStream;
-9 -1: init_lock
-18 -1: must be resolved: 
-42 -1: ()Ljava/nio/channels/spi/SelectorProvider;
-8 -1: ([JIIJ)V
-33 -1: IncompatibleClassChangeError.java
-34 -1: java/nio/ByteBufferAsDoubleBufferL
-31 -1: ()Ljava/util/function/Function;
-43 -1: Ljava/lang/Enum<Ljava/io/File$PathStatus;>;
-17 -1: availableCharsets
-49 -1: java/util/ArraysParallelSortHelpers$FJChar$Sorter
-22 -1: permission=<classname>
-22 -1: getAnnotatedSuperclass
-20 -1: isObjectPublicMethod
-15 -1: Attempt to get 
-10 -1: createLong
-14 -1: HASH_INCREMENT
-32 -1: sun/management/ManagementFactory
-13 -1: separatorChar
-15 -1: bad field type 
-8 -1: november
-27 -1: (F)Ljava/lang/StringBuffer;
-3 -1: EAT
-3 -1: mst
-54 -1: (Ljava/lang/reflect/Method;)Ljava/lang/reflect/Method;
-18 -1: Ljava/lang/Object;
-7 -1: ;:&=+$,
-12 -1: Handler.java
-7 -1: isDirty
-127 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
-14 -1: asTypeUncached
-5 -1: split
-200 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)Ljava/lang/reflect/AnnotatedType;
-47 -1: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
-22 -1: sun/invoke/empty/Empty
-66 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/Map;
-18 -1: jvm_update_version
-32 -1: (Ljava/util/Map;)Ljava/util/Map;
-14 -1: cacheLoadLimit
-8 -1: javaHome
-52 -1: (Ljava/lang/reflect/Field;)Ljava/lang/reflect/Field;
-20 -1: [[Ljava/lang/Object;
-19 -1: isJavaLetterOrDigit
-11 -1: loadLibrary
-32 -1: java/io/StreamCorruptedException
-14 -1: setAccessible0
-27 -1: sun/nio/cs/UTF_16LE$Encoder
-60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
-8 -1: segments
-10 -1: UTF_8.java
-3 -1: ECT
-5 -1: cp813
-5 -1: cp819
-61 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
-5 -1: Cache
-4 -1: sinh
-32 -1: java/util/function/ToIntFunction
-10 -1: setFactory
-24 -1: Illegal mappings count: 
-16 -1: fileToEncodedURL
-38 -1: Ljava/lang/annotation/RetentionPolicy;
-27 -1: Ljava/net/SocketPermission;
-46 -1: (Ljava/lang/CharSequence;I)[Ljava/lang/String;
-11 -1: cardinality
-13 -1: getMonthValue
-64 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodHandle;
-6 -1: ENDTOT
-12 -1: getBytesUTF8
-9 -1: cacheLoad
-13 -1: packageAccess
-14 -1: sharedToString
-5 -1: merge
-29 -1: parameter type cannot be void
-27 -1: makePreparedFieldLambdaForm
-40 -1: Couldn't find 3-letter country code for 
-166 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;Ljava/lang/ClassLoader;)V
-19 -1: (Ljava/util/Map;Z)V
-13 -1: setExecutable
-17 -1: objectFieldOffset
-57 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-128 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-61 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask
-6 -1: asType
-25 -1: java/io/ObjectStreamField
-15 -1: jvmMajorVersion
-124 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
-23 -1: (Ljava/lang/Class<*>;)C
-6 -1: andNot
-15 -1: getResponseCode
-59 -1: (Ljava/lang/StringBuffer;)Ljava/lang/AbstractStringBuilder;
-23 -1: (Ljava/lang/Class<*>;)I
-7 -1: seeAllp
-44 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class;)V
-13 -1: loadFromCache
-35 -1: sun/nio/cs/HistoricallyNamedCharset
-38 -1: (Ljava/lang/Class;[Ljava/lang/Class;)V
-19 -1: INVOKER_METHOD_TYPE
-16 -1: putShortVolatile
-12 -1: Asia/Karachi
-8 -1: cyrillic
-12 -1: getISO2Table
-23 -1: (Ljava/lang/Class<*>;)V
-3 -1: 1.4
-15 -1: LongBuffer.java
-6 -1: (IFZ)V
-23 -1: (Ljava/lang/Class<*>;)Z
-10 -1: initOutput
-9 -1: CELLSBUSY
-39 -1: java/security/PrivilegedActionException
-31 -1: sun/util/calendar/CalendarUtils
-202 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;[Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)[Ljava/lang/reflect/AnnotatedType;
-20 -1: Ljava/lang/Class<*>;
-5 -1: cp850
-25 -1: (JI)Ljava/nio/ByteBuffer;
-5 -1: cp852
-24 -1: Invalid parameter name "
-39 -1: ([CII)Ljava/lang/AbstractStringBuilder;
-5 -1: cp855
-11 -1: Deallocator
-5 -1: cp857
-5 -1: cp858
-7 -1: ([SI)[S
-37 -1: ([C)Ljava/lang/AbstractStringBuilder;
-27 -1: java/lang/SecurityException
-82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)V
-38 -1: (Ljava/lang/String;)Ljava/lang/String;
-7 -1: connect
-7 -1: isEmpty
-11 -1: replaceNode
-19 -1: SuppliedThreadLocal
-12 -1: asFixedArity
-12 -1: fromIndex = 
-19 -1: createMemoryManager
-9 -1: List.java
-8 -1: FEBRUARY
-21 -1: UnicodeLittleUnmarked
-6 -1: a null
-30 -1: ()Ljava/util/Spliterator<TT;>;
-5 -1: cp862
-17 -1: ZoneInfoFile.java
-5 -1: cp866
-8 -1: BulkTask
-53 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer
-20 -1: FileInputStream.java
-12 -1: java.vm.info
-10 -1: newDecoder
-5 -1: (JB)V
-8 -1: filePath
-17 -1: spreadArrayChecks
-44 -1: ([Ljava/lang/Object;Ljava/util/Comparator;)V
-33 -1: java/util/Collections$AsLIFOQueue
-32 -1: Ljava/util/LinkedList$Node<TE;>;
-5 -1: cp874
-78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
-39 -1: (JLjava/util/function/Consumer<-TK;>;)V
-15 -1: appendCodePoint
-20 -1: primitiveReturnCount
-54 -1:               only dump output if specified permission
-20 -1: getGenericInterfaces
-41 -1: ([Ljava/lang/reflect/AccessibleObject;Z)V
-17 -1: nUnstartedThreads
-33 -1: (Ljava/lang/invoke/MemberName;Z)V
-24 -1: ARRAY_OBJECT_INDEX_SCALE
-40 -1: (Ljava/lang/String;ILjava/util/Locale;)I
-17 -1: java/io/Flushable
-22 -1: newConstructorAccessor
-26 -1: sun/misc/JavaUtilJarAccess
-6 -1: booted
-10 -1: setDoInput
-36 -1: (Ljava/lang/Class;)[Ljava/lang/Enum;
-19 -1: java/lang/Character
-52 -1: ([Ljava/net/URL;Ljava/net/URLStreamHandlerFactory;)V
-24 -1: (Ljava/nio/LongBuffer;)I
-16 -1: start > length()
-28 -1: (I)Ljava/lang/CharacterData;
-5 -1: val$c
-61 -1: (Ljava/lang/Throwable;Ljava/lang/String;[Ljava/lang/Object;)V
-13 -1: resolveOrNull
-9 -1: L_ESCAPED
-27 -1: MapReduceValuesToDoubleTask
-15 -1: getPreparedForm
-33 -1: (I)[Ljava/util/WeakHashMap$Entry;
-54 -1: ()Ljava/util/stream/Stream<+Ljava/util/zip/ZipEntry;>;
-16 -1: bad method type 
-5 -1: val$s
-17 -1: Null charset name
-36 -1: java/lang/invoke/LambdaForm$Compiled
-24 -1: (Ljava/util/SortedMap;)V
-19 -1: java/time/LocalTime
-29 -1: not invocable, no method type
-21 -1: recalculateWordsInUse
-6 -1: val$id
-39 -1: sun/security/util/ManifestEntryVerifier
-60 -1: ([Ljava/lang/Class<*>;I)Ljava/lang/reflect/Constructor<TT;>;
-45 -1: java/util/ArrayPrefixHelpers$LongCumulateTask
-5 -1: OfInt
-11 -1: environment
-60 -1: ([Ljava/lang/Class<*>;[B)[[Ljava/lang/annotation/Annotation;
-7 -1: (JJJZ)V
-10 -1: BufferPool
-6 -1: isUTF8
-12 -1: threadLocals
-35 -1: (Ljava/lang/String;)[Ljava/net/URL;
-21 -1: Ljava/nio/LongBuffer;
-15 -1: copyConstructor
-25 -1: setCallSiteTargetVolatile
-15 -1: getNumericValue
-26 -1: Ljava/security/CodeSource;
-18 -1: Null output stream
-14 -1: cloneWithIndex
-23 -1: LOCAL_LISTEN_PERMISSION
-6 -1: (TT;)I
-46 -1: (Ljava/security/PublicKey;Ljava/lang/String;)V
-6 -1: setCrc
-26 -1: java/io/FilterOutputStream
-10 -1: access$000
-10 -1: access$001
-10 -1: access$002
-6 -1: (TT;)V
-78 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;IILjava/lang/Class<+[TT;>;)[TT;
-41 -1: java/util/concurrent/atomic/AtomicInteger
-8 -1: renameTo
-40 -1: (Ljava/lang/Class<*>;)Ljava/lang/Object;
-17 -1: getRawAnnotations
-29 -1: java/lang/VirtualMachineError
-37 -1: java/lang/management/MemoryPoolMXBean
-25 -1: (II)Ljava/util/List<TE;>;
-6 -1: utf_16
-23 -1: (Ljava/lang/String;[B)V
-19 -1: MIN_ARRAY_SORT_GRAN
-25 -1: array length is not legal
-45 -1: java/util/concurrent/locks/ReentrantLock$Sync
-36 -1: Ljava/security/AccessControlContext;
-48 -1: sun/reflect/generics/repository/MethodRepository
-24 -1: MethodHandleStatics.java
-24 -1: addThreadDumpForMonitors
-64 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<TT;>;)Ljava/util/Set<TT;>;
-58 -1: (Ljava/lang/String;[Ljava/lang/Object;Ljava/lang/Object;)Z
-37 -1: (III)Lsun/util/calendar/CalendarDate;
-9 -1: createURI
-15 -1: unreserveMemory
-52 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Method;
-66 -1: (Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-51 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/String;
-23 -1: inheritableThreadLocals
-63 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
-16 -1: setContentLength
-16 -1: LOWERCASE_LETTER
-4 -1: size
-25 -1: java.launcher.opt.hotspot
-19 -1: buildAnnotatedTypes
-26 -1: JAVAFX_LAUNCHER_CLASS_NAME
-11 -1: getAliasMap
-19 -1: CheckedNavigableSet
-15 -1: getAbsolutePath
-11 -1: doubleValue
-6 -1: utf_32
-22 -1: IMPLEMENTATION_VERSION
-3 -1: ne1
-11 -1: contentType
-8 -1: canWrite
-11 -1: Object.java
-14 -1: America/Denver
-8 -1: fileName
-13 -1: allPermDomain
-27 -1: ()Ljava/util/Iterator<TE;>;
-31 -1: (Lsun/reflect/MethodAccessor;)V
-11 -1: asTypeCache
-13 -1: lineSeparator
-9 -1: JarLoader
-15 -1: replacementNode
-18 -1: getContentEncoding
-12 -1: invoke_LLL_L
-22 -1: ()Ljava/util/TimeZone;
-17 -1: Reference Handler
-33 -1: java/lang/invoke/MethodHandleImpl
-47 -1: ()Ljava/util/concurrent/ConcurrentHashMap$Node;
-12 -1: invoke_LLL_V
-8 -1: form << 
-23 -1: (Ljava/lang/Object;JJ)J
-15 -1: isHighSurrogate
-31 -1: (Ljava/util/Collection<+TV;>;)Z
-36 -1: ([Ljava/util/HashMap$Node<TK;TV;>;)V
-23 -1: (Ljava/lang/Object;JJ)V
-12 -1: utf_32be_bom
-40 -1: sun/util/calendar/LocalGregorianCalendar
-27 -1: [Ljava/security/CodeSigner;
-15 -1: afterNodeAccess
-13 -1: nextThreadNum
-18 -1: INTERNED_ARGUMENTS
-11 -1: getMillisOf
-18 -1: offsetByCodePoints
-11 -1: writeObject
-48 -1: (Ljava/util/Locale$Category;Ljava/util/Locale;)V
-3 -1: nfe
-41 -1: (Ljava/util/Properties;Ljava/io/Reader;)V
-50 -1: (Ljava/util/concurrent/CountedCompleter;[C[CIIII)V
-15 -1: implFlushBuffer
-33 -1: (I)[Ljava/lang/invoke/MemberName;
-12 -1: Unicode.java
-17 -1: DMH.invokeVirtual
-5 -1: setup
-51 -1: (Ljava/util/Collection;[Ljava/lang/reflect/Field;)V
-3 -1: EST
-7 -1: TREEBIN
-7 -1: getFile
-10 -1: isLeapYear
-18 -1: LinkedHashIterator
-14 -1: DISPLAY_SCRIPT
-25 -1: privateGetDeclaredMethods
-68 -1: (Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
-22 -1: ()Ljava/util/Iterator;
-21 -1: sun/management/Sensor
-15 -1: getAvailableIDs
-51 -1: Lsun/util/PreHashedMap<Ljava/nio/charset/Charset;>;
-8 -1: elot_928
-6 -1: LATIN0
-45 -1: ([Ljava/lang/Object;II[Ljava/lang/Object;II)V
-10 -1: [Unlocked]
-15 -1: internArguments
-6 -1: LATIN9
-33 -1: (II)Ljava/lang/invoke/MethodType;
-12 -1: Version.java
-17 -1: setConnectTimeout
-75 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
-13 -1: highSurrogate
-12 -1: Africa/Cairo
-21 -1: synchronizedSortedMap
-21 -1:  in java.library.path
-45 -1: sun/reflect/generics/tree/FormalTypeParameter
-24 -1: UncaughtExceptionHandler
-14 -1: previousOrSame
-24 -1: java/security/Permission
-9 -1: x-ISCII91
-5 -1: L_HEX
-35 -1: java/lang/invoke/DirectMethodHandle
-35 -1: java/util/ArrayDeque$DeqSpliterator
-14 -1: java/util/List
-11 -1: toLowerCase
-24 -1: java/nio/charset/Charset
-10 -1: MIN_NORMAL
-110 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: regionMatches
-17 -1: newMethodAccessor
-26 -1: (Ljava/net/InetAddress;B)V
-68 -1: (Ljava/util/zip/ZipFile;Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
-22 -1: ()Ljava/io/FileSystem;
-19 -1: primitiveSimpleName
-5 -1: MOVED
-9 -1: STATE_RED
-13 -1: linkToSpecial
-19 -1: AnnotationType.java
-20 -1: (II)Ljava/util/List;
-252 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask;Ljava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)V
-12 -1: callSiteForm
-22 -1: isSiblingBindingBefore
-62 -1: <T:Ljava/lang/Object;>([TT;IITT;Ljava/util/Comparator<-TT;>;)I
-15 -1: buildEmptyNames
-11 -1: Thread.java
-30 -1: Ljava/lang/ref/Reference<TT;>;
-35 -1: sun/reflect/MethodAccessorGenerator
-152 -1: (Ljava/util/function/Function;Ljava/util/function/Function;Ljava/util/function/BinaryOperator;Ljava/util/function/Supplier;)Ljava/util/stream/Collector;
-5 -1: total
-242 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-27 -1: javax/security/auth/Subject
-43 -1: JVMTI_THREAD_STATE_BLOCKED_ON_MONITOR_ENTER
-17 -1: getSignerCertPath
-15 -1: registerNatives
-21 -1: sun/reflect/FieldInfo
-54 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/ISO_8859_1$1;)V
-17 -1: unwrapWithNoPrims
-17 -1: instanceof Long: 
-20 -1: hasRealParameterData
-23 -1: ()Ljava/time/LocalTime;
-14 -1: getAnnotations
-8 -1: optimize
-7 -1: setChar
-11 -1: OFFSET_MASK
-4 -1: TYPE
-177 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/concurrent/atomic/AtomicReference;)V
-18 -1: removeShutdownHook
-27 -1: ()Ljava/security/Principal;
-29 -1: JAVAFX_APPLICATION_CLASS_NAME
-6 -1: digits
-37 -1: [Ljava/lang/reflect/Constructor<TT;>;
-45 -1: ()Ljava/lang/Thread$UncaughtExceptionHandler;
-7 -1: tryLock
-19 -1: java/net/Proxy$Type
-21 -1: setJavaSecurityAccess
-13 -1: tieBreakOrder
-3 -1: no 
-16 -1: Australia/Sydney
-13 -1: DAY_IN_MILLIS
-19 -1: ()Ljava/nio/Buffer;
-12 -1: Integer.java
-14 -1: isBmpCodePoint
-6 -1: daemon
-23 -1: Lsun/misc/JavaIOAccess;
-106 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-10 -1: getFloatAt
-15 -1: content/unknown
-52 -1: ()Ljava/util/Enumeration<+Ljava/util/zip/ZipEntry;>;
-123 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-4 -1: nsme
-12 -1: prefixLength
-9 -1: flagsMods
-95 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-62 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm;
-16 -1: Illegal mode: 0x
-24 -1: java/io/FileOutputStream
-41 -1: [Pp][Ee][Rr][Mm][Ii][Ss][Ss][Ii][Oo][Nn]=
-24 -1: java/security/CodeSource
-16 -1: DUMP_CLASS_FILES
-25 -1: ([C)Ljava/nio/CharBuffer;
-12 -1: bindArgument
-50 -1: Ljava/lang/ref/FinalReference<Ljava/lang/Object;>;
-21 -1: unmodifiableSortedMap
-10 -1: jarHandler
-73 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
-67 -1: ()Ljava/util/Map<Ljava/lang/Thread;[Ljava/lang/StackTraceElement;>;
-15 -1: threadSeqNumber
-18 -1: AutoCloseable.java
-9 -1: holdsLock
-25 -1: (Ljava/lang/Object;JJJJ)V
-7 -1: (IJII)I
-15 -1: copyToLongArray
-58 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Package;>;
-84 -1: (Ljava/lang/invoke/MethodHandle;I[Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-32 -1: getExecutableTypeAnnotationBytes
-17 -1: streamHandlerLock
-35 -1: java/lang/IndexOutOfBoundsException
-15 -1: moveRootToFront
-28 -1: ()Ljava/nio/file/FileSystem;
-14 -1: content-length
-61 -1: (Ljava/lang/invoke/CallSite;Ljava/lang/invoke/MethodHandle;)V
-7 -1: csASCII
-18 -1: staticIsConsistent
-21 -1: sharedToGenericString
-8 -1: linkLast
-21 -1: isUnicodeExtensionKey
-7 -1: readInt
-7 -1: compile
-32 -1: ()Ljava/lang/reflect/Executable;
-4 -1: Big5
-20 -1: Ljava/util/Set<TE;>;
-18 -1: ExpiringCache.java
-44 -1: (Ljava/lang/String;[BII)Ljava/lang/Class<*>;
-18 -1: LinkedHashMap.java
-32 -1: Ljava/lang/UnsatisfiedLinkError;
-13 -1: parameterType
-28 -1: (ID)Ljava/lang/StringBuffer;
-15 -1: synchronizedSet
-9 -1: implClose
-6 -1: member
-14 -1: MH_INVOKE_MODS
-21 -1: forOutputStreamWriter
-37 -1: Lsun/misc/JavaIOFileDescriptorAccess;
-28 -1: java/lang/ProcessEnvironment
-17 -1: setNormalizedYear
-14 -1: isMalformed4_2
-14 -1: isMalformed4_3
-38 -1: (Ljava/lang/Object;)Ljava/lang/String;
-16 -1: getJavaAWTAccess
-12 -1: isPrivileged
-30 -1: java/util/Collections$EmptyMap
-17 -1: LinkedKeyIterator
-7 -1: vmcount
-27 -1: java/lang/ref/WeakReference
-5 -1: march
-13 -1: addOldMapping
-58 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)Lsun/misc/Cleaner;
-56 -1: (ILjava/lang/String;)[Ljava/lang/invoke/LambdaForm$Name;
-65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask
-55 -1: (Ljava/lang/invoke/SerializedLambda;)Ljava/lang/Object;
-17 -1: getEnclosingClass
-35 -1: (I)Lsun/util/calendar/BaseCalendar;
-13 -1: binarySearch0
-25 -1: ([J)Ljava/nio/LongBuffer;
-19 -1: java/util/Map$Entry
-22 -1: java/util/HashMap$Node
-26 -1: sun/reflect/MethodAccessor
-8 -1: LASTYEAR
-7 -1: disable
-36 -1: sun/launcher/LauncherHelper$FXHelper
-6 -1: toPath
-10 -1: shortValue
-6 -1: remove
-59 -1: ([Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
-55 -1: java/util/concurrent/ConcurrentHashMap$ValueSpliterator
-64 -1: (Ljava/util/Collection;Ljava/lang/Object;)Ljava/util/Collection;
-15 -1: asPrimitiveType
-16 -1: PrintStream.java
-10 -1: image/jpeg
-22 -1: specificToStringHeader
-7 -1: class "
-38 -1: java/util/Collections$CheckedSortedMap
-19 -1: SUPPRESSED_SENTINEL
-16 -1: getEnumConstants
-54 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuilder;
-36 -1: Ljava/lang/Class<Ljava/lang/Short;>;
-13 -1: toThreadState
-38 -1: (Ljava/lang/Class;)Ljava/lang/Package;
-24 -1: (C)Ljava/lang/Character;
-19 -1: UNTREEIFY_THRESHOLD
-4 -1: NCPU
-23 -1: ()Ljava/lang/Exception;
-42 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)V
-15 -1: nothingToVerify
-15 -1: setInitialValue
-15 -1: getTimeInMillis
-12 -1: getDoubleAt0
-18 -1: parameterTypeCache
-86 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;)Ljava/nio/file/WatchKey;
-49 -1: java/util/concurrent/ConcurrentHashMap$ValuesView
-13 -1: <all actions>
-7 -1: exitVM.
-34 -1: Ljava/lang/ClassNotFoundException;
-68 -1: (Ljava/util/Map;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-28 -1: getCalendarDateFromFixedDate
-28 -1: UnsafeFieldAccessorImpl.java
-27 -1: java/lang/RuntimePermission
-74 -1: Ljava/lang/Object;Ljava/lang/Comparable<Lsun/util/locale/BaseLocale$Key;>;
-62 -1: ()Ljava/util/Iterator<Ljava/nio/charset/spi/CharsetProvider;>;
-13 -1: LanguageRange
-239 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-37 -1: DIRECTIONALITY_LEFT_TO_RIGHT_OVERRIDE
-62 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodType;
-16 -1: DMH.invokeStatic
-11 -1: (TK;TV;)TV;
-7 -1: ([FI)[F
-14 -1: newPerfCounter
-35 -1: ([JI)Ljava/util/Spliterator$OfLong;
-30 -1: java/util/AbstractList$ListItr
-5 -1: cp912
-5 -1: cp914
-45 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;)V
-6 -1: LOCNAM
-8 -1: launcher
-5 -1: cp915
-14 -1: standardString
-26 -1: ()Ljava/lang/Thread$State;
-10 -1: L_ALPHANUM
-8 -1: (C[CII)I
-9 -1: SEPTEMBER
-20 -1: java/text/DateFormat
-38 -1: Ljava/lang/CloneNotSupportedException;
-5 -1: cp920
-23 -1: getConstructorSignature
-16 -1: ReferenceHandler
-19 -1: America/Puerto_Rico
-5 -1: cp923
-10 -1: typeString
-30 -1: Self-suppression not permitted
-25 -1: (Ljava/io/OutputStream;)V
-9 -1: implReset
-12 -1: fullAddCount
-34 -1: java/lang/invoke/LambdaForm$Hidden
-25 -1: ()Lsun/misc/JavaIOAccess;
-9 -1: Math.java
-9 -1: getAndSet
-7 -1: failure
-14 -1: LINE_SEPARATOR
-6 -1: parent
-30 -1: java/lang/BootstrapMethodError
-8 -1: indexMap
-9 -1: ALL_KINDS
-23 -1: desiredAssertionStatus0
-39 -1: (ILjava/lang/Object;)Ljava/lang/Object;
-22 -1: RuntimePermission.java
-21 -1: getContextClassLoader
-14 -1: VARARGS_INVOKE
-8 -1: zoneinfo
-130 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;ILjava/lang/invoke/DirectMethodHandle$1;)V
-18 -1: java/lang/Readable
-11 -1: containsAll
-11 -1: newPosition
-57 -1: sun/reflect/InstantiationExceptionConstructorAccessorImpl
-13 -1: REVERSE_ORDER
-29 -1: Required array size too large
-6 -1: sunday
-44 -1: <T:Ljava/lang/Object;>()Ljava/util/Set<TT;>;
-10 -1: toIntExact
-33 -1: ([BIILjava/nio/charset/Charset;)V
-14 -1: indexOfSubList
-15 -1: tryAcquireNanos
-31 -1: java/lang/InvalidClassException
-22 -1: SecureClassLoader.java
-12 -1: proxiedHosts
-7 -1: ([CII)I
-11 -1: toHexString
-30 -1: sun/util/calendar/ZoneInfoFile
-31 -1: Ljava/util/jar/Attributes$Name;
-10 -1: L_USERINFO
-25 -1: (IB)Ljava/nio/ByteBuffer;
-11 -1: parseDouble
-7 -1: ([CII)V
-13 -1: Asia/Shanghai
-5 -1: [...]
-57 -1: ([Ljava/lang/Class;[B)[[Ljava/lang/annotation/Annotation;
-19 -1: java/nio/LongBuffer
-15 -1: getCertificates
-9 -1: comparing
-83 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)V
-43 -1: Ljava/util/concurrent/atomic/AtomicInteger;
-23 -1: toFieldDescriptorString
-20 -1: Lsun/misc/MetaIndex;
-37 -1: java/util/Collections$UnmodifiableSet
-5 -1: (JC)V
-37 -1: nanosecond timeout value out of range
-26 -1: AbstractStringBuilder.java
-43 -1: java/lang/invoke/DirectMethodHandle$Special
-49 -1: ([Ljava/nio/file/LinkOption;)Ljava/nio/file/Path;
-15 -1: currentPosition
-14 -1: java/net/Proxy
-13 -1: asConstructor
-8 -1: userInfo
-14 -1: parseClassPath
-15 -1: legacyMergeSort
-34 -1: java/security/UnresolvedPermission
-97 -1: Lsun/util/locale/LocaleObjectCache<Lsun/util/locale/BaseLocale$Key;Lsun/util/locale/BaseLocale;>;
-9 -1: freeEntry
-19 -1: delimiterCodePoints
-34 -1: Should be non-empty if initialized
-23 -1: (I)Ljava/lang/Class<*>;
-11 -1: Reader.java
-26 -1: checkClassLoaderPermission
-27 -1: java/nio/DirectShortBufferS
-95 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/Launcher$ExtClassLoader;>;
-27 -1: java/nio/DirectShortBufferU
-20 -1: ()[Ljava/lang/Class;
-56 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-19 -1: sun/nio/cs/UTF_16BE
-24 -1: java/util/AbstractList$1
-10 -1: ([CIIIII)V
-60 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/lang/Object;>;
-37 -1: (Ljava/lang/invoke/LambdaForm$Name;)S
-9 -1: putDouble
-52 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration;
-37 -1: (Ljava/lang/invoke/LambdaForm$Name;)Z
-22 -1: ()[Ljava/lang/Package;
-41 -1: java/lang/CharSequence$1CodePointIterator
-13 -1: auditSubclass
-24 -1: Ljava/util/jar/JarEntry;
-20 -1: findMethodHandleType
-15 -1: MAX_BUFFER_SIZE
-19 -1: FilePermission.java
-18 -1: WrappedPrintStream
-36 -1: (D)Ljava/lang/AbstractStringBuilder;
-11 -1: unfinalized
-10 -1: getFileURL
-37 -1: (Ljava/io/FileFilter;)[Ljava/io/File;
-54 -1: (Ljava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
-7 -1: ([ZI)[Z
-64 -1: (Ljava/security/CodeSource;)Ljava/security/PermissionCollection;
-6 -1: PUBLIC
-83 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
-17 -1: lockInterruptibly
-67 -1: ([Ljava/util/Hashtable$Entry;Ljava/lang/Object;Ljava/lang/Object;)V
-42 -1: java/util/ArraysParallelSortHelpers$FJChar
-21 -1: defaultCharBufferSize
-14 -1: unalignedKnown
-23 -1: ()Ljava/net/Proxy$Type;
-4 -1: TZDB
-14 -1: CharacterCache
-13 -1: lengthOfMonth
-13 -1: hasExtensions
-23 -1: Prefix string too short
-15 -1: Executable.java
-10 -1: forEachKey
-6 -1: getEra
-13 -1: appendEncoded
-21 -1: java/util/AbstractMap
-10 -1: access$100
-10 -1: access$102
-30 -1: javafx.application.Application
-46 -1: (Ljava/lang/Thread$UncaughtExceptionHandler;)V
-43 -1: Ljava/lang/invoke/LambdaForm$NamedFunction;
-101 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
-9 -1: WILD_CHAR
-21 -1: SynchronizedSortedSet
-28 -1: (Ljava/util/Collection<*>;)Z
-29 -1: (I[C)Ljava/lang/StringBuffer;
-65 -1: (Ljava/lang/String;[Ljava/lang/Class;Z)Ljava/lang/reflect/Method;
-7 -1: putByte
-6 -1: H_MARK
-49 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/Object;
-98 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;Z)Ljava/lang/ClassValue$Entry<*>;
-23 -1: array is not of length 
-52 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;TT;TT;)Z
-41 -1: Ljava/util/Collections$EmptyListIterator;
-8 -1:         
-11 -1: updateCheck
-29 -1: getBootClassPathEntryForClass
-27 -1: sun/nio/cs/US_ASCII$Encoder
-10 -1: bindCaller
-18 -1: Ljava/util/BitSet;
-10 -1: checkRange
-77 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Void;)V
-7 -1: Classes
-6 -1: store0
-23 -1: java/lang/Thread$Caches
-25 -1: Ljava/lang/CharacterData;
-7 -1: (JI[C)V
-49 -1: (Ljava/util/LinkedList;Ljava/util/LinkedList$1;)V
-16 -1: getGcInfoBuilder
-12 -1: counterCells
-14 -1: memoryLimitSet
-7 -1: , nojit
-9 -1: sharpsMap
-7 -1: october
-13 -1: isProxiedHost
-9 -1: rawOffset
-18 -1: toJavaFormatString
-19 -1: sun.boot.class.path
-60 -1: (ILjava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
-11 -1: spliterator
-13 -1: contentLength
-18 -1: unixTimeToFileTime
-31 -1: Lsun/reflect/LangReflectAccess;
-16 -1:  while Java has 
-79 -1: (JLjava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)I
-12 -1: timeEndOfDay
-17 -1: getCustomTimeZone
-25 -1: Ljava/lang/ref/Reference;
-20 -1: ()Ljava/util/Locale;
-64 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;Z)V
-13 -1: MAX_JVM_ARITY
-72 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/lang/invoke/MethodType;
-11 -1: AsLIFOQueue
-84 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/lang/Object;)Ljava/util/List<TT;>;
-12 -1: mappingCount
-29 -1: (Ljava/io/FileOutputStream;)V
-50 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;TT;)V
-23 -1: Category cannot be NULL
-10 -1: normalized
-5 -1: CLASS
-28 -1: (IZ)Ljava/lang/StringBuffer;
-18 -1: java/lang/System$1
-18 -1: java/lang/System$2
-9 -1: getResult
-44 -1: ()Ljava/util/Collection<Ljava/lang/Thread;>;
-8 -1: isNative
-59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Short;>;
-24 -1: [Ljava/lang/ThreadGroup;
-24 -1: (B)Ljava/nio/ByteBuffer;
-4 -1: READ
-44 -1: (Ljava/io/FilePermission;)Ljava/lang/String;
-93 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$SynchronizedCollection<TE;>;Ljava/util/Set<TE;>;
-12 -1: compileClass
-12 -1: isProxyClass
-20 -1: isSystemDomainLoader
-74 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/util/Comparator<-TT;>;)V
-7 -1: getMask
-72 -1: (Ljava/lang/ClassLoader;Ljava/lang/SecurityManager;Ljava/lang/String;I)V
-20 -1: removeLastOccurrence
-64 -1: (Ljava/lang/reflect/Field;)Ljava/lang/invoke/DirectMethodHandle;
-57 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
-11 -1: parkBlocker
-40 -1: (Lsun/misc/JarIndex;Ljava/lang/String;)V
-33 -1: [Ljava/security/ProtectionDomain;
-14 -1: setContentType
-14 -1: getEnumeration
-18 -1: ProtectionDomain  
-76 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar$Date;
-16 -1: setRequestMethod
-52 -1: (Ljava/util/List;Ljava/lang/Object;)Ljava/util/List;
-32 -1: Lsun/util/calendar/BaseCalendar;
-52 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/lang/String;
-5 -1: .:@[]
-7 -1: addLast
-21 -1: AnnotatedElement.java
-10 -1: defaultVal
-16 -1: getCanonicalPath
-17 -1: protection_domain
-9 -1: strictfp 
-19 -1: sun/nio/cs/UTF_16LE
-9 -1: readBytes
-18 -1: removeStaleEntries
-46 -1: java/util/Collections$UnmodifiableNavigableSet
-5 -1: cpath
-14 -1: COPY_THRESHOLD
-8 -1: permsMap
-8 -1: japanese
-33 -1: java/nio/charset/StandardCharsets
-47 -1: Lsun/reflect/DelegatingConstructorAccessorImpl;
-19 -1: NF_checkGenericType
-40 -1: java/util/Collections$UnmodifiableList$1
-4 -1: TERM
-48 -1: The following can be used with stack and domain:
-27 -1: ([BII)Ljava/nio/ByteBuffer;
-40 -1: Ljava/util/Vector<Ljava/lang/Class<*>;>;
-5 -1: digit
-7 -1: isFinal
-39 -1: (Ljava/lang/String;Ljava/lang/String;)I
-26 -1: memberDeclaringClassOrNull
-10 -1: ([CI[BII)I
-38 -1: (Ljava/lang/Class;I)Ljava/lang/Object;
-15 -1: isValidProtocol
-17 -1: (this Collection)
-11 -1: getTreeNode
-16 -1: ThreadLocal.java
-23 -1: java/nio/HeapLongBuffer
-39 -1: (Ljava/lang/String;Ljava/lang/String;)V
-12 -1: getNextEntry
-39 -1: (Ljava/lang/String;Ljava/lang/String;)Z
-28 -1: (C)Lsun/invoke/util/Wrapper;
-9 -1: readFloat
-21 -1: overrideFieldAccessor
-16 -1: fillInStackTrace
-16 -1: getDeclaredField
-5 -1: deflt
-8 -1: nextChar
-10 -1: primCounts
-22 -1: getAnnotatedInterfaces
-26 -1: ()Ljava/util/zip/Inflater;
-73 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;)TU;
-16 -1: traceMethodCalls
-10 -1: sun.nio.cs
-7 -1: marshal
-9 -1: ftypeKind
-77 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-11 -1: sun/misc/VM
-14 -1: GuardWithCatch
-40 -1: (Ljava/lang/Object;)Ljava/util/Iterator;
-13 -1: subtractExact
-42 -1: (Ljava/lang/Object;ILjava/lang/Object;II)V
-10 -1: isInfinite
-18 -1: sun.util.calendar.
-14 -1: java/lang/Math
-16 -1: java/lang/String
-10 -1: encodePath
-14 -1: compactAndTrim
-11 -1: getVariants
-4 -1: from
-47 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;)V
-35 -1: serializeAgentPropertiesToByteArray
-16 -1: computeIfPresent
-9 -1: EMPTY_MAP
-28 -1: java/lang/InstantiationError
-68 -1: (Ljava/util/Comparator;Ljava/util/Comparator;)Ljava/util/Comparator;
-14 -1: getDisplayName
-14 -1: limitedContext
-23 -1: usagetracker.properties
-52 -1: java/util/concurrent/locks/ReentrantLock$NonfairSync
-7 -1: public 
-17 -1: srcBegin > srcEnd
-48 -1: (ILjava/util/List;)Ljava/lang/invoke/MethodType;
-21 -1: java/lang/ThreadDeath
-9 -1: gregorian
-111 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/HashMap$TreeNode;
-52 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;III)V
-12 -1: generateFile
-20 -1: appendParameterTypes
-22 -1: sun/misc/FileURLMapper
-13 -1: defaultDomain
-25 -1: (I)Ljava/time/ZoneOffset;
-21 -1: getBooleanAttributes0
-39 -1: (Ljava/lang/String;)Lsun/misc/Resource;
-43 -1: Ljava/lang/Thread$UncaughtExceptionHandler;
-23 -1: getTypeAnnotationBytes0
-8 -1: ELOT_928
-32 -1: sun/nio/cs/FastCharsetProvider$1
-34 -1: Ljava/nio/BufferOverflowException;
-14 -1: AppClassLoader
-10 -1: protected 
-12 -1: isAnnotation
-16 -1: PerfCounter.java
-51 -1: Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
-160 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-11 -1: setLeapYear
-16 -1: parseContextSpec
-16 -1: setFieldAccessor
-8 -1: writeInt
-16 -1: java/lang/Number
-33 -1: java/util/AbstractMap$SimpleEntry
-9 -1: nextTable
-8 -1: getQuery
-14 -1: putOrderedLong
-93 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-52 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/Tree;
-85 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;)V
-9 -1: singleton
-9 -1: destroyed
-15 -1: iso_8859-2:1987
-12 -1: comparingInt
-29 -1: [Ljava/lang/OutOfMemoryError;
-39 -1: (Ljava/lang/String;Ljava/lang/Object;)V
-27 -1: ([Ljava/util/Enumeration;)V
-36 -1: Ljava/nio/charset/CodingErrorAction;
-16 -1: getCanonicalName
-41 -1: (Ljava/nio/LongBuffer;)Ljava/util/BitSet;
-15 -1: DISPLAY_COUNTRY
-32 -1: getFunctionalInterfaceMethodName
-66 -1: (Ljava/lang/String;Ljava/util/Map;Ljava/util/Map;Ljava/util/Map;)V
-24 -1: getUnresolvedPermissions
-66 -1: ([Ljava/lang/ClassValue$Entry<*>;I)Ljava/lang/ClassValue$Entry<*>;
-41 -1: ()Lsun/reflect/annotation/AnnotationType;
-7 -1: afIndex
-7 -1: csascii
-20 -1: ()Ljava/util/Vector;
-16 -1: EntrySpliterator
-53 -1: (Ljava/lang/Throwable;I)Ljava/lang/StackTraceElement;
-81 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-20 -1: classAssertionStatus
-7 -1: EXECUTE
-21 -1: ()Ljava/lang/Runtime;
-6 -1: cesu-8
-7 -1: offset 
-23 -1: Ljava/lang/SafeVarargs;
-34 -1: (Ljava/util/LinkedHashMap$Entry;)V
-8 -1: entryFor
-8 -1: getCache
-46 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Field;
-4 -1: skip
-8 -1: (II[CI)V
-4 -1: vart
-12 -1: InnerClasses
-68 -1: (Ljava/util/Map;Ljava/lang/Class;[Ljava/lang/String;)Ljava/util/Map;
-19 -1: currentClassLoader0
-34 -1: getDefaultUncaughtExceptionHandler
-11 -1: String.java
-117 -1: (Ljava/lang/ThreadLocal<*>;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-7 -1: january
-31 -1: (ILjava/lang/String;IIIIIIIII)V
-24 -1: Lsun/misc/JavaAWTAccess;
-5 -1: .path
-15 -1: [Ljava/io/File;
-11 -1: Writer.java
-8 -1: , Size: 
-159 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/function/Consumer;)V
-32 -1: java/lang/invoke/LambdaForm$Name
-51 -1: (Ljava/util/ArrayList;Ljava/util/AbstractList;III)V
-7 -1: getZone
-14 -1: JIS_X0212-1990
-21 -1: (Ljava/util/Set<*>;)Z
-149 -1: (Lsun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter;Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/Object;
-21 -1: Illegal Load factor: 
-35 -1: ()Ljava/lang/invoke/MethodTypeForm;
-22 -1: ([Z)Ljava/lang/String;
-7 -1: setName
-48 -1: <T:Ljava/lang/Object;>(TT;Ljava/lang/String;)TT;
-9 -1: INTERFACE
-22 -1: ARRAY_CHAR_INDEX_SCALE
-19 -1: java/nio/ByteBuffer
-23 -1: Ljava/io/ExpiringCache;
-7 -1: streams
-44 -1: java/lang/invoke/DirectMethodHandle$Accessor
-36 -1: ([Ljava/security/ProtectionDomain;)V
-16 -1: afterNodeRemoval
-9 -1: prevIndex
-49 -1: java/util/concurrent/ConcurrentHashMap$KeySetView
-22 -1: getEnumConstantsShared
-17 -1: java/lang/Integer
-12 -1: getRawOffset
-36 -1: ()Ljava/nio/file/attribute/FileTime;
-7 -1: offsets
-10 -1: ] throw =>
-3 -1: [[B
-10 -1: hostsEqual
-18 -1: compareComparables
-35 -1: sun/reflect/ConstructorAccessorImpl
-8 -1: december
-36 -1: Invalid binary time-zone data: TZDB:
-24 -1: synchronizedNavigableMap
-72 -1: sun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter
-19 -1: parseCustomTimeZone
-88 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-9 -1: findClass
-6 -1: OBJECT
-3 -1: GBK
-110 -1: (JLjava/util/function/ToLongFunction<Ljava/util/Map$Entry<TK;TV;>;>;JLjava/util/function/LongBinaryOperator;)J
-6 -1: UTF_16
-17 -1: <all permissions>
-13 -1: lookupCharset
-28 -1: ConstructorAccessorImpl.java
-62 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask
-30 -1: Ljava/lang/ClassCastException;
-56 -1: ()Ljava/util/Spliterator<Ljava/util/Map$Entry<TK;TV;>;>;
-11 -1: invokerType
-23 -1: java/lang/StringBuilder
-12 -1: deleteCharAt
-11 -1: CR_OVERFLOW
-14 -1: toExternalForm
-3 -1: out
-34 -1: Ljava/net/URLStreamHandlerFactory;
-15 -1: encodeArrayLoop
-30 -1: ()Ljava/util/Enumeration<TK;>;
-27 -1: java/io/SyncFailedException
-10 -1: checkedSet
-16 -1: checkedSortedSet
-22 -1: java/util/zip/ZipEntry
-43 -1: java/util/LinkedHashMap$LinkedValueIterator
-22 -1: UnmodifiableCollection
-32 -1: java/nio/ByteBufferAsCharBufferB
-11 -1: blockerLock
-27 -1: checkExtensionsDependencies
-11 -1: fromIndex: 
-32 -1: java/nio/ByteBufferAsCharBufferL
-6 -1: UTF_32
-30 -1: java/util/Hashtable$Enumerator
-92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<+TK;+TV;>;)Ljava/util/Map<TK;TV;>;
-4 -1: tail
-5 -1: (BB)C
-16 -1: isValidSignature
-9 -1: addMillis
-9 -1: peekFirst
-86 -1: <E:Ljava/lang/Object;>(Ljava/util/Set<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Set<TE;>;
-5 -1: (BB)I
-15 -1: jvmMicroVersion
-28 -1: [Ljava/util/Hashtable$Entry;
-15 -1: iso_8859-5:1988
-14 -1: HOUR_IN_MILLIS
-67 -1: (Ljava/util/PrimitiveIterator$OfInt;I)Ljava/util/Spliterator$OfInt;
-5 -1: (BB)S
-21 -1: UnmodifiableSortedMap
-79 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap;)V
-56 -1: Ljava/util/Stack<Ljava/lang/ClassLoader$NativeLibrary;>;
-5 -1: (BB)Z
-10 -1: treeifyBin
-8 -1: isOpaque
-27 -1: java.launcher.ergo.message1
-27 -1: java.launcher.ergo.message2
-101 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Cloneable;Ljava/lang/Comparable<Ljava/util/Date;>;
-31 -1: (Ljava/io/ObjectOutputStream;)V
-3 -1: GET
-13 -1: matchLocation
-13 -1: WrappedMember
-63 -1: NoSuchMethodException:\n  could not find proper constructor for 
-14 -1: gssloginconfig
-70 -1: (Ljava/util/LinkedList$Node<TE;>;TE;Ljava/util/LinkedList$Node<TE;>;)V
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Z)Ljava/lang/Object;
-11 -1: toByteArray
-49 -1: java/util/ArraysParallelSortHelpers$FJByte$Sorter
-13 -1: no protocol: 
-940 -1: aaaarababkaeaveafafrakakaamamhanargararaasasmavavaayaymazazebabakbebelbgbulbhbihbibisbmbambnbenbobodbrbrebsboscacatcechechchacocoscrcrecscescuchucvchvcycymdadandedeudvdivdzdzoeeeweelellenengeoepoesspaetesteueusfafasfffulfifinfjfijfofaofrfrafyfrygaglegdglaglglggngrngugujgvglvhahauhehebhihinhohmohrhrvhthathuhunhyhyehzheriainaidindieileigiboiiiiiikipkinindioidoisislititaiuikuiwhebjajpnjiyidjvjavkakatkgkonkikikkjkuakkkazklkalkmkhmknkankokorkrkaukskaskukurkvkomkwcorkykirlalatlbltzlgluglilimlnlinlolaoltlitlulublvlavmgmlgmhmahmimrimkmkdmlmalmnmonmomolmrmarmsmsamtmltmymyananaunbnobndndenenepngndonlnldnnnnononornrnblnvnavnynyaocociojojiomormororiososspapanpipliplpolpspusptporququermrohrnrunroronrurusrwkinsasanscsrdsdsndsesmesgsagsisinskslkslslvsmsmosnsnasosomsqsqisrsrpsssswstsotsusunsvsweswswatatamteteltgtgkththatitirtktuktltgltntsntotontrturtstsotttattwtwitytahuguigukukrururduzuzbvevenvivievovolwawlnwowolxhxhoyiyidyoyorzazhazhzhozuzul
-42 -1: java/util/LinkedHashMap$LinkedHashIterator
-39 -1: java/util/ArrayDeque$DescendingIterator
-15 -1: MODIFIER_LETTER
-21 -1: (Lsun/misc/Cleaner;)Z
-12 -1: PACKAGE_NAME
-14 -1: getMappedValue
-10 -1: interrupt0
-8 -1: LF_LIMIT
-17 -1: getDeclaringClass
-42 -1: (ZILjava/lang/String;)Ljava/lang/Class<*>;
-57 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;[I)V
-15 -1: java/nio/Bits$1
-61 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class;
-28 -1: java/lang/ref/ReferenceQueue
-33 -1: [Ljava/security/cert/Certificate;
-44 -1: (Ljava/util/Hashtable;I)Ljava/util/Iterator;
-24 -1: java/security/CodeSigner
-19 -1: Non-positive length
-24 -1: [Ljava/util/Enumeration;
-38 -1: ()Ljava/security/PermissionCollection;
-16 -1: checkGenericType
-56 -1: java/util/concurrent/ConcurrentHashMap$ReduceEntriesTask
-7 -1: getYear
-5 -1: atime
-19 -1: Ljava/util/HashMap;
-125 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-22 -1: STOP_THREAD_PERMISSION
-46 -1: (Ljava/util/Enumeration;)Ljava/util/ArrayList;
-16 -1: getPathSeparator
-10 -1: getMembers
-8 -1: getIntAt
-26 -1: java/io/File$TempDirectory
-48 -1: java/lang/invoke/MethodHandleImpl$GuardWithCatch
-25 -1: CaseInsensitiveComparator
-8 -1: pollLast
-21 -1: GET_POLICY_PERMISSION
-23 -1: uninitialized call site
-75 -1: (Ljava/util/function/Function;Ljava/util/Comparator;)Ljava/util/Comparator;
-9 -1: directory
-51 -1: (JLjava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
-41 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)V
-42 -1: (Ljava/lang/Throwable;Ljava/lang/String;)V
-26 -1: (FLjava/lang/Appendable;)V
-5 -1: stop0
-9 -1: substring
-64 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)V
-5 -1: (JD)V
-9 -1: getShortB
-10 -1: nextOrSame
-24 -1: [ interpretWithArguments
-6 -1: GB2312
-32 -1: java/nio/BufferOverflowException
-23 -1: sun/nio/cs/ArrayEncoder
-4 -1: tanh
-9 -1: getShortL
-55 -1: (JLjava/util/function/BiFunction;)Ljava/util/Map$Entry;
-10 -1: getMessage
-12 -1: findTreeNode
-38 -1: DIRECTIONALITY_COMMON_NUMBER_SEPARATOR
-23 -1: [Ljava/lang/Comparable;
-17 -1: getCallSiteTarget
-55 -1: (Ljava/nio/ByteBuffer;II)Ljava/nio/charset/CoderResult;
-19 -1: java/util/ArrayList
-17 -1: java/io/DataInput
-13 -1: getPrincipals
-52 -1: <E:Ljava/lang/Object;>(TE;)Ljava/util/Iterator<TE;>;
-44 -1: sun/reflect/generics/tree/ClassTypeSignature
-6 -1: loaded
-20 -1: ()Ljava/lang/Object;
-36 -1: Ljava/util/concurrent/ConcurrentMap;
-13 -1: classValueMap
-33 -1: java/lang/SystemClassLoaderAction
-6 -1: loader
-31 -1: java/lang/annotation/Annotation
-5 -1: colon
-11 -1: Vector.java
-24 -1: CharacterDataLatin1.java
-12 -1: setUseCaches
-22 -1: getTypeAnnotationBytes
-9 -1: readShort
-24 -1: longPrimitiveReturnCount
-5 -1: get16
-34 -1: setDefaultUncaughtExceptionHandler
-17 -1: cachedInputStream
-29 -1: java/util/LinkedHashMap$Entry
-17 -1: java/lang/Boolean
-50 -1: ()[Lsun/reflect/generics/tree/FormalTypeParameter;
-14 -1: AnnotationData
-21 -1: Ljava/net/Proxy$Type;
-13 -1: invokeVirtual
-14 -1: Parameter.java
-21 -1: getDayOfWeekDateAfter
-92 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-56 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-46 -1: sun/util/locale/provider/LocaleProviderAdapter
-29 -1: Ljava/lang/StackTraceElement;
-47 -1: (TK;Ljava/util/function/Function<-TK;+TV;>;)TV;
-32 -1: enableContextClassLoaderOverride
-68 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/AbstractStringBuilder;
-51 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-9 -1: addAndGet
-5 -1: store
-7 -1: ([JII)V
-15 -1: signatureReturn
-18 -1: NF_reinvokerTarget
-22 -1: ()Ljava/nio/file/Path;
-25 -1: (C)Ljava/lang/Appendable;
-7 -1: expires
-18 -1: initializeInvokers
-19 -1: application/java-vm
-13 -1: stopOrSuspend
-13 -1: rawOffsetDiff
-6 -1: (JJZ)V
-9 -1: findValue
-5 -1: get32
-10 -1: asSubclass
-6 -1: forJRE
-3 -1: GMT
-7 -1: delete0
-69 -1: ([Ljava/security/cert/Certificate;[Ljava/security/cert/Certificate;)Z
-75 -1: (Ljava/util/LinkedList$Node;Ljava/lang/Object;Ljava/util/LinkedList$Node;)V
-6 -1: setEra
-24 -1: ()Ljava/util/Comparator;
-10 -1: access$200
-10 -1: access$202
-20 -1: retrieveDisplayNames
-3 -1: pae
-24 -1: java/lang/Byte$ByteCache
-7 -1: VM.java
-9 -1: TRANSIENT
-6 -1: setErr
-16 -1: jdkUpdateVersion
-10 -1: isResolved
-35 -1: sun/misc/JavaIOFileDescriptorAccess
-4 -1: char
-13 -1: Readable.java
-19 -1: UnixFileSystem.java
-43 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/Object;
-40 -1: (Ljava/lang/String;[Ljava/lang/String;)V
-7 -1: profile
-11 -1: , version: 
-25 -1: PermissionCollection.java
-13 -1: setNormalized
-10 -1: access$210
-24 -1: (Ljava/lang/String;IJZ)J
-19 -1: isAnnotationPresent
-85 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-19 -1: DMH.invokeInterface
-157 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;TV;>;Ljava/util/Collection<TV;>;Ljava/io/Serializable;
-94 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableCollection<TE;>;Ljava/util/List<TE;>;
-41 -1: java/lang/StringIndexOutOfBoundsException
-29 -1: java/net/UnknownHostException
-11 -1: (BBBBBBBB)J
-4 -1: iioe
-12 -1: (TK;TV;Z)TV;
-5 -1: ERROR
-31 -1: (Ljava/io/File;Ljava/io/File;)I
-32 -1: [Ljava/lang/invoke/MethodHandle;
-27 -1: lambda$comparing$77a9974f$1
-13 -1: toLowerCaseEx
-61 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
-66 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/HashMap$TreeNode;
-43 -1: java/util/concurrent/ConcurrentHashMap$Node
-23 -1: latestUserDefinedLoader
-24 -1: buildAnnotatedSuperclass
-19 -1: compareToIgnoreCase
-31 -1: (Ljava/io/File;Ljava/io/File;)Z
-40 -1: (I[C)[Ljava/lang/invoke/LambdaForm$Name;
-16 -1: ROTATE_THRESHOLD
-18 -1: getClassAtIfLoaded
-37 -1: java/lang/IllegalThreadStateException
-5 -1: get64
-12 -1: writeReplace
-14 -1: DAYS_PER_CYCLE
-4 -1: _get
-6 -1: nChars
-26 -1: ()Ljava/net/SocketAddress;
-27 -1: setUncaughtExceptionHandler
-6 -1: jzfile
-42 -1: All subclasses should override this method
-3 2: Foo
-56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
-3 -1: pdt
-44 -1: sun/util/locale/LocaleObjectCache$CacheEntry
-20 -1: java/util/Comparator
-9 -1: suspended
-11 -1: removeEntry
-10 -1: SPACE_FREE
-12 -1: processQueue
-9 -1: java.home
-5 -1: valid
-23 -1: printEnclosedStackTrace
-4 -1: push
-5 -1: guard
-23 -1: javaNetHttpCookieAccess
-36 -1: (Ljava/security/cert/Certificate;)[B
-9 -1: isWrapped
-12 -1: CharIterator
-26 -1: sun.io.useCanonPrefixCache
-42 -1: (Lsun/misc/Cleaner;Ljava/lang/Throwable;)V
-7 -1: prepare
-8 -1: parseInt
-13 -1: Invokers.java
-63 -1: (Ljava/net/URLClassLoader;)Ljava/security/AccessControlContext;
-18 -1: defaultWriteObject
-5 -1: class
-15 -1: EnclosingMethod
-23 -1: ([BI)Ljava/lang/String;
-16 -1: rangeCheckForAdd
-11 -1: getTimeImpl
-15 -1: arrayIndexScale
-5 -1: scalb
-5 -1: scale
-45 -1: (Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
-8 -1: ([FIIF)I
-16 -1: runAllFinalizers
-27 -1: ()Lsun/net/ProgressMonitor;
-15 -1: MemberName.java
-27 -1: [Ljava/lang/reflect/Member;
-6 -1: length
-14 -1: genericInvoker
-8 -1: ([FIIF)V
-34 -1: Ljava/nio/file/attribute/FileTime;
-6 -1: number
-70 -1: (Ljava/lang/StringBuilder;Ljava/lang/String;)Ljava/lang/StringBuilder;
-12 -1: printLocales
-38 -1: java/lang/invoke/MethodHandleStatics$1
-8 -1: private 
-20 -1: invalid actions mask
-10 -1:  not found
-13 -1: parseClassSig
-22 -1: getAllAvailableLocales
-175 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/concurrent/atomic/AtomicReference;)V
-8 -1: ([BII)[B
-35 -1: (Ljava/util/HashMap$Node<TK;TV;>;)V
-132 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;[Ljava/lang/Object;[I[Ljava/lang/Object;)V
-8 -1: ([BII)[C
-20 -1: DECIMAL_DIGIT_NUMBER
-40 -1: (Ljava/lang/String;[Ljava/lang/Object;)Z
-7 -1: ([CCI)I
-64 -1: (TV;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-8 -1: aliasMap
-8 -1: checkfpx
-44 -1: java/util/Comparators$NaturalOrderComparator
-48 -1: (Ljava/lang/ClassLoader;)Ljava/lang/ClassLoader;
-12 -1: Name is null
-10 -1: invoke_L_L
-8 -1: URL.java
-51 -1: (JILjava/time/ZoneOffset;)Ljava/time/LocalDateTime;
-25 -1: Lsun/invoke/util/Wrapper;
-19 -1: LauncherHelper.java
-10 -1: invoke_L_V
-5 -1: index
-30 -1: sun/security/x509/X509CertImpl
-8 -1: addClass
-46 -1: (I)Ljava/lang/invoke/LambdaForm$NamedFunction;
-20 -1: refKindIsConstructor
-10 -1: getFieldAt
-5 -1: log10
-13 -1: GetPerfAction
-15 -1: isLetterOrDigit
-27 -1: hasCheckedSpecialAttributes
-25 -1: MapReduceEntriesToIntTask
-17 -1: probeHomeLocation
-9 -1: image/png
-19 -1: checkSpreadArgument
-12 -1: LinkedKeySet
-13 -1: removeMapping
-39 -1: sun/security/util/SecurityConstants$AWT
-9 -1: MAX_RADIX
-28 -1: (F)Ljava/lang/StringBuilder;
-11 -1: ([C[B[I[I)Z
-36 -1: (Ljava/lang/Class;)Ljava/lang/Class;
-32 -1: java/lang/invoke/MagicLambdaImpl
-6 -1: monday
-16 -1: closeClassLoader
-41 -1: (Ljava/util/concurrent/locks/Condition;)I
-8 -1: reversed
-27 -1: sun/util/calendar/Gregorian
-49 -1: (Lsun/nio/cs/FastCharsetProvider;)Ljava/util/Map;
-42 -1: (Ljava/lang/String;Ljava/lang/Throwable;)V
-18 -1: java/util/Calendar
-8 -1: vmtarget
-17 -1: TREEIFY_THRESHOLD
-41 -1: (Ljava/util/concurrent/locks/Condition;)Z
-9 -1: deadChild
-8 -1: EntrySet
-5 -1: log1p
-58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap;)V
-9 -1: pageCount
-14 -1: slotToArgTable
-24 -1: toMethodDescriptorString
-25 -1: ([B)Ljava/nio/ByteBuffer;
-21 -1: twoToTheDoubleScaleUp
-32 -1: sun/misc/URLClassPath$FileLoader
-40 -1: (Ljava/util/List<Ljava/lang/String;>;Z)V
-6 -1: cache1
-6 -1: cache2
-27 -1: Ljava/net/URLStreamHandler;
-20 -1: Detect premature EOF
-94 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamEncoder;
-12 -1: NF_checkBase
-20 -1: (Ljava/nio/Buffer;)V
-45 -1: <E:Ljava/lang/Object;>Ljava/util/Vector<TE;>;
-4 -1: Sync
-12 -1: H_UNRESERVED
-32 -1: (Ljava/util/Map;)Ljava/util/Set;
-32 -1: (Ljava/util/Map$Entry<TK;TV;>;)Z
-25 -1: java/util/Locale$Category
-8 -1: receiver
-9 -1: MAX_VALUE
-4 -1: .RSA
-25 -1: Ljava/net/URLClassLoader;
-15 -1: Terminator.java
-26 -1: (Ljava/lang/String;TV;)TV;
-4 -1: null
-76 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-9 -1: checkCast
-39 -1: ()Ljava/lang/AssertionStatusDirectives;
-15 -1: declaredMethods
-5 -1: clazz
-21 -1:    Retention policy: 
-20 -1: spreadArgElementType
-9 -1: WORD_MASK
-27 -1: ([IILjava/io/InputStream;)I
-11 -1: getMethodAt
-31 -1: (Ljava/net/URL;Ljava/net/URL;)Z
-13 -1: getLocaleName
-14 -1: isEnumConstant
-41 -1: (Ljava/lang/String;)Ljava/nio/CharBuffer;
-16 -1: newInvokeSpecial
-26 -1: (Ljava/nio/ByteBuffer;IS)V
-22 -1: sun/misc/JavaNioAccess
-184 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
-96 -1: (Ljava/lang/invoke/MethodHandle;ILjava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-5 -1: ([S)I
-30 -1: java/security/AccessController
-37 -1: sun/misc/Launcher$SharedArchiveLoader
-4 -1: pack
-5 -1: ([S)V
-51 -1: failure       before throwing exception, dump stack
-10 -1: dayOfMonth
-6 -1: CENSIG
-28 -1: java/util/function/Predicate
-26 -1: Malformed \\uxxxx encoding.
-9 -1: initIndex
-11 -1: invoke_LL_L
-23 -1: ConcurrentWeakInternSet
-14 -1: java/lang/Void
-42 -1: java/lang/String$CaseInsensitiveComparator
-38 -1: Ljava/lang/invoke/LambdaForm$Compiled;
-34 -1: java/util/Collections$SingletonSet
-142 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class;)Ljava/lang/invoke/CallSite;
-35 -1: too many bootstrap method arguments
-17 -1: maxDelimCodePoint
-13 -1: previousIndex
-3 -1: pop
-6 -1: CENSIZ
-7 -1: ([Z[Z)Z
-11 -1: invoke_LL_V
-3 -1: pos
-33 -1: java/nio/file/WatchEvent$Modifier
-3 -1: pow
-12 -1: nextClearBit
-15 -1: Dictionary.java
-27 -1: sun/reflect/CallerSensitive
-13 -1: signatureType
-10 -1: dstSavings
-13 -1: UnicodeLittle
-16 -1: America/New_York
-82 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
-25 -1: referenceKindIsConsistent
-62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/LongBuffer;>;
-4 -1: INTS
-11 -1: LOAD_FACTOR
-40 -1: sun/reflect/DelegatingMethodAccessorImpl
-16 -1: accumulateAndGet
-21 -1: (B)Ljava/lang/String;
-6 -1: UNSAFE
-13 -1: resolveOrFail
-21 -1: MapReduceMappingsTask
-5 -1: arity
-77 -1: (Ljava/io/FileDescriptor;ZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
-5 -1: value
-61 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView<TK;TV;>;
-6 -1: forJar
-52 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/Reference<TT;>;
-21 -1: CREATE_ACC_PERMISSION
-28 -1: sun/misc/NativeSignalHandler
-11 -1: defineClass
-5 -1: match
-93 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/ZipFile$ZipFileInputStream;Ljava/util/zip/Inflater;I)V
-11 -1: Double.java
-30 -1: America/Argentina/Buenos_Aires
-8 -1: previous
-37 -1: (Ljava/io/Writer;Ljava/lang/String;)V
-9 -1: Synthetic
-18 -1: isVMAnonymousClass
-62 -1: ([Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
-22 -1: (JI)Ljava/lang/String;
-49 -1: (Ljava/lang/CharSequence;II)Ljava/io/PrintStream;
-52 -1: ([Ljava/lang/Thread;)[[Ljava/lang/StackTraceElement;
-12 -1: setDayOfWeek
-11 -1: getManifest
-30 -1: java/util/Locale$FilteringMode
-54 -1: (Ljava/lang/String;)Lsun/util/calendar/CalendarSystem;
-12 -1: nextHashCode
-19 -1: ()Ljava/io/Console;
-42 -1: AccessControlContext invoking the Combiner
-19 -1: shouldBeInitialized
-17 -1: invocationCounter
-21 -1: IMPLEMENTATION_VENDOR
-7 -1: chararr
-60 -1: (Ljava/lang/String;)Ljava/util/Iterator<Ljava/lang/String;>;
-11 -1: asCollector
-52 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuilder;
-9 -1: exception
-22 -1: newInstanceCallerCache
-20 -1: nativeLibraryContext
-24 -1: MODIFY_THREAD_PERMISSION
-4 -1: WRAP
-19 -1: Method name is null
-32 -1: sun/invoke/util/ValueConversions
-7 -1: APP_TAG
-24 -1: (Ljava/util/Hashtable;)I
-23 -1: METHOD_FORMAL_PARAMETER
-18 -1: inflationThreshold
-24 -1: java/io/DeleteOnExitHook
-3 -1: pst
-13 -1: BITS_PER_WORD
-25 -1: getConstructorAnnotations
-17 -1: CheckedCollection
-24 -1: (Ljava/util/Hashtable;)V
-7 -1: inClass
-5 -1: getFD
-8 -1: readLong
-19 -1: aliases_ISO_8859_13
-19 -1: invokeWithArguments
-19 -1: aliases_ISO_8859_15
-42 -1: ()Ljava/util/concurrent/ConcurrentHashMap;
-8 -1: expandTo
-23 -1: java/text/MessageFormat
-8 -1: classID0
-11 -1: replaceWith
-21 -1: Invalid port number :
-65 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)V
-19 -1: isGregorianLeapYear
-16 -1: asSpreaderChecks
-11 -1: withInitial
-10 -1: X-UTF-32BE
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-12 -1: wrong type: 
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Z
-17 -1: sun/misc/Resource
-14 -1: getReadTimeout
-8 -1: safeTrim
-38 -1: DIRECTIONALITY_RIGHT_TO_LEFT_EMBEDDING
-14 -1: isElementIndex
-23 -1: FilterOutputStream.java
-6 -1: (IJI)V
-3 -1: put
-57 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
-43 -1: Expecting an absolute path of the library: 
-8 -1: checkRef
-53 -1: (Ljava/lang/String;)Ljava/lang/AbstractStringBuilder;
-74 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-11 -1: user.script
-10 -1: H_ALPHANUM
-17 -1: getCalendarSystem
-48 -1: Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
-17 -1: EnsureInitialized
-82 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
-243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask;Ljava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)V
-26 -1: getAnnotatedExceptionTypes
-10 -1: validIndex
-6 -1: ([CC)I
-8 -1: overflow
-5 -1: getID
-93 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamDecoder;
-22 -1: java/util/StringJoiner
-9 -1: putFields
-18 -1: USE_SHARED_ARCHIVE
-8 -1: thursday
-8 -1: nanoTime
-59 -1: (Lsun/reflect/annotation/AnnotationType;Ljava/lang/Class;)V
-69 -1: (Ljava/nio/charset/CoderResult$Cache;I)Ljava/nio/charset/CoderResult;
-36 -1: (J)Ljava/lang/AbstractStringBuilder;
-16 -1: java/util/Arrays
-6 -1: ([CC)V
-25 -1: registerAsParallelCapable
-4 -1: slot
-24 -1: java/net/URLConnection$1
-6 -1: koi8-r
-19 -1:  should be of type 
-46 -1: java/util/concurrent/ConcurrentHashMap$TreeBin
-6 -1: koi8-u
-34 -1: data type scale not a power of two
-53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
-21 -1: AccessibleObject.java
-53 -1: <E:Ljava/lang/Object;>()Ljava/util/NavigableSet<TE;>;
-88 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List;
-17 -1: getAnnotationType
-36 -1: Ljava/util/HashMap$TreeNode<TK;TV;>;
-14 -1: declaringClass
-10 -1: read,write
-5 -1: getId
-10 -1: BIG_ENDIAN
-20 -1: PolymorphicSignature
-16 -1: comparingByValue
-67 -1: (ILjava/lang/invoke/MethodType;)[Ljava/lang/invoke/LambdaForm$Name;
-19 -1: java/util/Hashtable
-20 -1: getUnicodeLocaleKeys
-27 -1: ()Ljava/util/LinkedHashMap;
-51 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuilder;
-30 -1: java/util/HashMap$HashIterator
-22 -1: (IZ)Ljava/lang/String;
-5 -1: yield
-34 -1: java/lang/Throwable$SentinelHolder
-62 -1: (Ljava/lang/invoke/MethodType;ZI)Ljava/lang/invoke/LambdaForm;
-5 -1: (FD)F
-17 -1: java/util/SubList
-24 -1: (Ljava/io/PrintStream;)V
-7 -1: LF.zero
-25 -1: java/util/StringTokenizer
-15 -1: ISO8859_15_FDIS
-11 -1: powerOfTwoD
-11 -1: powerOfTwoF
-22 -1: WeakHashMapSpliterator
-15 -1: refKindIsGetter
-12 -1: setRawOffset
-11 -1: setProperty
-23 -1: (Ljava/lang/Object;IB)V
-45 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node;
-13 -1: applyAsDouble
-83 -1: (Lsun/misc/URLClassPath$FileLoader;Ljava/lang/String;Ljava/net/URL;Ljava/io/File;)V
-19 -1: MethodAccessor.java
-9 -1: WALL_TIME
-7 -1: INVOKES
-13 -1: java.ext.dirs
-9 -1: getStatic
-56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/String;
-42 -1: (Ljava/util/function/UnaryOperator<TE;>;)V
-27 -1: java/lang/Class$MethodArray
-10 -1: H_USERINFO
-19 -1: PostVMInitHook.java
-7 -1: running
-32 -1: Warning: passing argument as-is 
-13 -1: EntryIterator
-22 -1: NF_checkSpreadArgument
-46 -1: ([DLjava/util/function/IntToDoubleFunction;I)V
-7 -1: .<init>
-13 -1: mappingLength
-20 -1: implOnMalformedInput
-53 -1: (Ljava/lang/String;ILjava/lang/reflect/Executable;I)V
-26 -1: cannot make variable arity
-18 -1: SharedSecrets.java
-27 -1: (Ljava/io/InputStream;IZ)[B
-9 -1: Asia/Gaza
-55 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
-5 -1: NTLM 
-19 -1: defaultCenturyStart
-18 -1: addElapsedTimeFrom
-38 -1: (Lsun/misc/Cleaner;)Lsun/misc/Cleaner;
-44 -1: (Ljava/io/OutputStream;ZLjava/lang/String;)V
-22 -1: (Ljava/lang/Object;B)V
-6 1: [LBar;
-7 -1: classes
-23 -1: java/net/URLClassLoader
-17 -1: sun/misc/Launcher
-163 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-12 -1: updateAndGet
-90 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-9 -1: increment
-27 -1: (Ljava/lang/CharSequence;)V
-16 -1: Ljava/io/Reader;
-27 -1: java/io/PushbackInputStream
-6 -1: (JFZ)V
-17 -1: getAppClassLoader
-35 -1: sun/reflect/generics/tree/Signature
-9 -1: elementAt
-27 -1: (Ljava/lang/CharSequence;)Z
-10 -1: readDouble
-37 -1: ([B)Ljava/nio/charset/CharsetEncoder;
-46 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;)V
-4 -1: park
-36 -1: java/lang/NegativeArraySizeException
-49 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Z
-121 -1: <T:Ljava/lang/Object;U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
-101 -1: (Ljava/lang/annotation/Annotation;Ljava/lang/annotation/Annotation;)Ljava/lang/annotation/Annotation;
-12 -1: .$|()[{^?*+\\
-6 -1: manRef
-3 -1: 437
-15 -1: newStringUnsafe
-15 -1: constantPoolOop
-10 -1: getPackage
-24 -1: FastCharsetProvider.java
-18 -1: getAnnotationBytes
-187 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
-33 -1: Cannot suppress a null exception.
-27 -1: sun/nio/cs/StandardCharsets
-33 -1: (BB)Ljava/lang/invoke/MemberName;
-61 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;)I
-10 -1: X-UTF-32LE
-5 -1: toMap
-89 -1: (Ljava/lang/Class<*>;Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-46 -1: ([Ljava/lang/Object;IILjava/util/Comparator;)V
-66 -1: ([Ljava/lang/reflect/Constructor;)[Ljava/lang/reflect/Constructor;
-22 -1: ()Ljava/nio/ByteOrder;
-20 -1: isMethodHandleInvoke
-25 -1: sun/net/www/URLConnection
-89 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/invoke/LambdaForm;>;
-49 -1: (Ljava/nio/charset/Charset;FFLjava/lang/String;)V
-17 -1: MIN_LOW_SURROGATE
-23 -1: AbstractCollection.java
-19 -1: (Ljava/util/Date;)I
-19 -1: (Ljava/util/Date;)J
-12 -1: cldrdata.jar
-4 -1: path
-77 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)V
-6 -1: MS1250
-37 -1: setJavaSecurityProtectionDomainAccess
-11 -1: isDelimiter
-5 -1: char0
-6 -1: MS1251
-5 -1: char1
-16 -1: getJavaNetAccess
-6 -1: MS1252
-6 -1: MS1253
-6 -1: MS1254
-51 -1: (Ljava/lang/Class;)Ljava/security/ProtectionDomain;
-6 -1: MS1257
-93 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-10 -1: access$300
-5 -1: (JZ)C
-19 -1: (Ljava/util/Date;)Z
-5 -1: (JZ)D
-26 -1: java/lang/Character$Subset
-10 -1: access$302
-5 -1: (JZ)F
-9 -1: emptyList
-5 -1: (JZ)I
-5 -1: (JZ)J
-23 -1: (Ljava/lang/Runnable;)V
-27 -1: java/lang/invoke/MemberName
-29 -1: ()Ljava/util/Comparator<TT;>;
-18 -1: retrieveDirectives
-7 -1: ([F[F)Z
-40 -1: (Lsun/misc/URLClassPath;Ljava/net/URL;)V
-5 -1: (JZ)S
-40 -1: (Ljava/util/function/IntUnaryOperator;)I
-5 -1: (JZ)V
-16 -1: parseAnnotations
-21 -1: (C)Ljava/lang/String;
-73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(TK;TV;)Ljava/util/Map<TK;TV;>;
-15 -1: charset encoder
-17 -1: getDomainCombiner
-9 -1: EmptyList
-15 -1: java.vm.version
-19 -1: getResourceAsStream
-94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringEncoder;>;>;
-26 -1: java/util/HashMap$TreeNode
-22 -1: (Ljava/util/HashMap;)V
-23 -1: sun/misc/URLClassPath$1
-65 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)Ljava/net/URLClassLoader;
-20 -1: Hashtable Enumerator
-23 -1: sun/misc/URLClassPath$2
-10 -1: Array.java
-8 -1: FT_LIMIT
-24 -1: ()[Ljava/lang/Throwable;
-23 -1: sun/misc/URLClassPath$3
-14 -1: java/io/Writer
-5 -1: chars
-76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/NavigableMap<TK;TV;>;
-6 -1:  final
-5 -1: error
-34 -1: java/lang/ApplicationShutdownHooks
-29 -1: Lsun/launcher/LauncherHelper;
-30 -1: ()Ljava/util/Enumeration<TE;>;
-47 -1: (Ljava/util/List;)Ljava/lang/invoke/MethodType;
-9 -1: scriptKey
-5 -1: BYTES
-12 -1: getException
-69 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
-14 -1: Illegal Load: 
-189 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceValuesTask;Ljava/util/function/BiFunction;)V
-66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask
-29 -1: getJavaIOFileDescriptorAccess
-11 -1: toCodePoint
-15 -1: setCreationTime
-18 -1: NULL_CAUSE_MESSAGE
-8 -1: elements
-32 -1: ()Ljava/nio/charset/CoderResult;
-8 -1: utf-32be
-7 -1: addDate
-4 -1: Cast
-23 -1: sun/misc/JavaLangAccess
-8 -1: 0{1,12}$
-27 -1: (Ljava/util/ArrayList;III)V
-11 -1: lastIndexOf
-14 -1: getCodeSources
-53 -1: (Lsun/util/calendar/CalendarDate;Ljava/lang/String;)V
-17 -1: cachedConstructor
-7 -1: forName
-74 -1: (Ljava/util/function/ToLongFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-47 -1: (Ljava/lang/Object;)Lsun/reflect/FieldAccessor;
-8 -1: getDebug
-18 -1: currentClassLoader
-49 -1: Illegal leading minus sign on unsigned string %s.
-20 -1: toLowerCaseCharArray
-38 -1: java/util/concurrent/ConcurrentHashMap
-8 -1: isHidden
-92 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;)V
-29 -1: java/lang/ArithmeticException
-26 -1: (Ljava/io/OutputStream;Z)V
-66 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/RuntimeException;
-38 -1: Ljava/util/Map<Ljava/lang/String;TT;>;
-16 -1: getFindClassTime
-34 -1: ([J)Ljava/util/Spliterator$OfLong;
-24 -1: UnmodifiableNavigableSet
-32 -1: java/lang/ClassNotFoundException
-3 -1: \\n 
-6 -1: SEALED
-14 -1: Flushable.java
-3 -1: HST
-24 -1: (Ljava/lang/Object;JII)Z
-13 -1: toSecondOfDay
-16 -1: thenComparingInt
-26 -1: java/lang/NoSuchFieldError
-18 -1: java/util/Locale$1
-25 -1: [Ljava/util/HashMap$Node;
-75 -1: ([Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-11 -1: x-mswin-936
-32 -1: java/lang/management/MemoryUsage
-25 -1: (JS)Ljava/nio/ByteBuffer;
-25 -1: java/lang/ref/Finalizer$1
-25 -1: java/lang/ref/Finalizer$2
-21 -1: (Ljava/util/BitSet;)V
-25 -1: java/lang/ref/Finalizer$3
-83 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;Ljava/util/Comparator<-TT;>;)TT;
-24 -1: sun/nio/ch/Interruptible
-21 -1: (Ljava/util/BitSet;)Z
-72 -1: ([Ljava/security/ProtectionDomain;Ljava/security/AccessControlContext;)V
-54 -1: Ljava/util/AbstractSet<Ljava/util/Map$Entry<TK;TV;>;>;
-34 -1: getConstructorParameterAnnotations
-4 -1: name
-92 -1: <E:Ljava/lang/Enum<TE;>;>Ljava/lang/Object;Ljava/lang/Comparable<TE;>;Ljava/io/Serializable;
-11 -1: FORM_OFFSET
-13 -1: getAliasTable
-5 -1: (DD)D
-23 -1: reflectionFactoryAccess
-221 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-59 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/nio/file/Path;
-6 -1: DELETE
-10 -1: returnType
-5 -1: (DD)I
-51 -1: ()Lsun/reflect/generics/repository/FieldRepository;
-8 -1: delegate
-12 -1: OTHER_LETTER
-18 -1: getTransitionIndex
-3 -1: HUP
-10 -1: (IIII[CI)V
-10 -1: ISO_8859-1
-17 -1: ArrayEncoder.java
-10 -1: ISO_8859-2
-34 -1: java/lang/reflect/AnnotatedElement
-10 -1: ISO_8859-4
-27 -1: sun/nio/cs/UTF_16LE$Decoder
-10 -1: ISO_8859-5
-13 -1: prefetchWrite
-9 -1: getFloatB
-10 -1: ISO_8859-7
-37 -1: (I)Ljava/lang/invoke/LambdaForm$Name;
-10 -1: ISO_8859-9
-10 -1: getActions
-11 -1: negateExact
-10 -1: isAbstract
-9 -1: getFloatL
-29 -1: java/lang/ClassValue$Identity
-14 -1: java/io/Reader
-8 -1: getOwner
-24 -1: java/lang/AssertionError
-17 -1: MethodHandle.java
-19 -1: classRedefinedCount
-10 -1: cachedYear
-15 -1: getAndIncrement
-26 -1: java.protocol.handler.pkgs
-14 -1: cleanSomeSlots
-27 -1: java/util/Spliterator$OfInt
-31 -1: getRawExecutableTypeAnnotations
-20 -1: ensureInitialization
-7 -1: os.arch
-57 -1: (Ljava/security/cert/CertPath;Ljava/security/Timestamp;)V
-21 -1: UNSAFE_COPY_THRESHOLD
-20 -1: toUnsignedBigInteger
-82 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection<Ljava/lang/Thread;>;
-15 -1: Reflection.java
-12 -1: decryptBlock
-3 -1: \\r 
-8 -1: newArray
-8 -1: Category
-36 -1: java/lang/reflect/GenericDeclaration
-22 -1: (Ljava/lang/String;Z)V
-8 -1: suspend0
-10 -1: getSigners
-22 -1: (Ljava/lang/String;Z)Z
-31 -1: Unable to create temporary file
-117 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-17 -1: channelsAvailable
-9 -1: Date.java
-13 -1: toIndex < 0: 
-18 -1: mark > position: (
-11 -1: loadConvert
-4 -1: july
-42 -1: (Ljava/math/BigInteger;)Ljava/lang/String;
-6 -1: enable
-47 -1: (Ljava/util/zip/ZipEntry;)Ljava/io/InputStream;
-6 -1: unpack
-13 -1: setDayOfMonth
-19 -1: name can't be empty
-16 -1: getExtensionKeys
-15 -1: getAndDecrement
-36 -1: Ljava/lang/ClassValue$ClassValueMap;
-38 -1: (Ljava/lang/Class;Ljava/lang/String;)V
-11 -1: csISOlatin0
-9 -1: retention
-23 -1: system protocol handler
-9 -1: nullsLast
-15 -1: refKindIsStatic
-3 -1:  (\n
-48 -1: sun/launcher/LauncherHelper$ResourceBundleHolder
-29 -1: ()Ljava/util/LinkedList<TE;>;
-11 -1: csISOlatin9
-31 -1: ([CII)Ljava/lang/StringBuilder;
-29 -1: (II)Ljava/lang/StringBuilder;
-7 -1: pdcache
-4 -1: june
-12 -1: ;/?:@&=+$,[]
-141 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)[Ljava/lang/invoke/LambdaForm$Name;
-32 -1: ()[Ljava/util/WeakHashMap$Entry;
-110 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-81 -1: (Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-46 -1: String value %s exceeds range of unsigned int.
-6 -1: close0
-6 -1: (JDZ)V
-160 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/reflect/GenericDeclaration;Ljava/lang/reflect/Type;Ljava/lang/reflect/AnnotatedElement;
-12 -1: LinkedValues
-24 -1: java/nio/HeapCharBufferR
-23 -1: jvmVersionInfoAvailable
-16 -1: classLoaderDepth
-33 -1: (Lsun/nio/ch/DirectBuffer;IIIII)V
-32 -1: java/nio/file/attribute/FileTime
-50 -1: java/util/concurrent/ConcurrentHashMap$CounterCell
-73 -1: (Lsun/misc/URLClassPath$JarLoader;Lsun/misc/JarIndex;)Lsun/misc/JarIndex;
-60 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
-25 -1: Ljava/lang/ref/Finalizer;
-12 -1: utf-32be-bom
-40 -1: (Ljava/lang/String;ILjava/lang/Object;)V
-9 -1: THROW_UCS
-23 -1: java/util/AbstractMap$1
-23 -1: java/util/AbstractMap$2
-10 -1: x-utf-32be
-4 -1: (S)B
-60 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/LambdaForm;
-20 -1: ResourceBundleHolder
-4 -1: (S)I
-13 -1: getSuppressed
-17 -1: jdk_micro_version
-4 -1: (S)J
-9 -1: isNumeric
-10 -1: variantKey
-8 -1: utf-32le
-47 -1: java/util/concurrent/ConcurrentHashMap$MapEntry
-25 -1: ()Ljava/lang/Class<-TT;>;
-6 -1: closed
-4 -1: (S)S
-15 -1: setStandardTime
-10 -1: ShortCache
-4 -1: (S)V
-40 -1: sun/net/www/MessageHeader$HeaderIterator
-17 -1: jdk_major_version
-8 -1: FXHelper
-6 -1: CENTIM
-19 -1: java/security/Guard
-46 -1: java.lang.invoke.MethodHandle.DUMP_CLASS_FILES
-4 -1: ENUM
-27 -1: Ljava/lang/SecurityManager;
-39 -1: ([Ljava/lang/Class;[Ljava/lang/Class;)Z
-11 -1: getFieldAt0
-12 -1: user.variant
-28 -1: (Ljava/io/DataInputStream;)V
-44 -1: ([JLjava/util/function/LongBinaryOperator;)V
-7 -1: getRoot
-3 -1:  + 
-16 -1: identityHashCode
-25 -1: java/security/Permissions
-16 -1: Ljava/net/Proxy;
-23 -1: java/io/ExpiringCache$1
-5 -1:  more
-10 -1: formatList
-49 -1: (Ljava/lang/String;)Lsun/launcher/LauncherHelper;
-29 -1: Relative path in absolute URI
-11 -1: checkMapped
-8 -1: Checksum
-8 -1: " Radix:
-9 -1: getAndAdd
-9 -1: implReady
-16 -1: SynchronizedList
-30 -1: [Ljava/lang/StackTraceElement;
-5 -1: right
-13 -1: UTF_16BE.java
-4 -1: HEAD
-11 -1: isInvocable
-6 -1: ENDCOM
-15 -1: getPropertiesEx
-6 -1: Unsafe
-7 -1: IBM-819
-37 -1: : 0 <= i2 && i2 < names.length: 0 <= 
-19 -1: filterAndAddHeaders
-22 -1: nativeParkEventPointer
-18 -1: checkPositionIndex
-13 -1: invalid url: 
-25 -1:  out of range from input 
-9 -1: loadClass
-12 -1: encodingName
-9 -1: x-JIS0208
-38 -1: (Ljava/lang/Class;Ljava/lang/Object;)Z
-28 -1: (I)Ljava/lang/reflect/Field;
-17 -1: getJvmVersionInfo
-6 -1: LIJFDV
-21 -1: (D)Ljava/lang/String;
-7 -1: oomeMsg
-30 -1: java/io/InvalidObjectException
-25 -1: java/io/FilterInputStream
-32 -1: Ljava/net/ContentHandlerFactory;
-13 -1: toUnsignedInt
-17 -1: reconstitutionPut
-37 -1: (Ljava/lang/Object;)Ljava/lang/Class;
-14 -1: getContentType
-43 -1: java/util/Collections$SynchronizedSortedSet
-24 -1: (II)Ljava/nio/file/Path;
-25 -1: JAVAFX_APPLICATION_MARKER
-29 -1: (IC)Ljava/lang/StringBuilder;
-13 -1: java/util/Set
-10 -1: clearError
-64 -1: (Ljava/lang/invoke/MethodType;[I)Ljava/lang/invoke/MethodHandle;
-25 -1: java/io/FileInputStream$1
-8 -1: getFirst
-36 -1: (Lsun/reflect/ConstructorAccessor;)V
-84 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/NavigableMap;
-42 -1: (Ljava/lang/CharSequence;)Ljava/io/Writer;
-52 -1: ([Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-6 -1: (IFI)V
-62 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Queue<TE;>;
-17 -1: getHeaderFieldInt
-16 -1: CheckedSortedMap
-39 -1: (ZILjava/lang/String;)Ljava/lang/Class;
-10 -1: getterName
-10 -1: Asia/Tokyo
-4 -1: Node
-7 -1: rotate1
-13 -1: Stream closed
-7 -1: rotate2
-9 -1: checkExec
-17 -1: NF_checkExactType
-18 -1: ReverseComparator2
-18 -1: arrayElementGetter
-97 -1: (Ljava/util/ArrayPrefixHelpers$DoubleCumulateTask;Ljava/util/function/DoubleBinaryOperator;[DII)V
-9 -1: iso8859-1
-9 -1: iso8859-2
-9 -1: iso8859-4
-9 -1: iso8859-5
-9 -1: iso8859-7
-16 -1:  getPermissions 
-9 -1: iso8859-9
-9 -1: fromClass
-17 -1:  with modifiers "
-8 -1: isBooted
-24 -1: getCommonPoolParallelism
-10 -1: initialize
-47 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Set<TT;>;
-17 -1: checkElementIndex
-14 -1: openConnection
-47 -1: (Ljava/lang/Thread;Lsun/nio/ch/Interruptible;)V
-12 -1: isAuthorized
-17 -1: ReduceEntriesTask
-7 -1: command
-24 -1: ArithmeticException.java
-24 -1: ensureOpenOrZipException
-67 -1: (Lsun/util/calendar/CalendarDate;I)Lsun/util/calendar/CalendarDate;
-39 -1: Ljava/lang/invoke/MethodHandles$Lookup;
-31 -1: Enclosing constructor not found
-34 -1: ()Lsun/util/calendar/BaseCalendar;
-25 -1: (JLjava/lang/Object;JJJ)V
-12 -1:  > toIndex: 
-22 -1: LocaleObjectCache.java
-19 -1: sun/misc/Launcher$1
-31 -1: java/util/HashMap$EntryIterator
-8 -1: contains
-60 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
-53 -1: (I[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-19 -1: java/io/PrintStream
-42 -1: java/lang/Math$RandomNumberGeneratorHolder
-100 -1: <K:Ljava/lang/Object;>(I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
-14 -1: getCapturedArg
-14 -1: getCodeSigners
-20 -1: mark() not supported
-56 -1: (Lsun/misc/URLClassPath;I)Lsun/misc/URLClassPath$Loader;
-20 -1: java/lang/StrictMath
-14 -1: annotationType
-3 -1: IET
-4 -1: lang
-13 -1: JarEntry.java
-9 -1: ([CIIII)I
-9 -1: canEncode
-5 -1: extra
-30 -1: java/lang/ref/ReferenceQueue$1
-37 -1: java/nio/channels/ReadableByteChannel
-73 -1: (Ljava/util/Map$Entry<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;)Z
-24 -1: java/io/BufferedReader$1
-10 -1: x-utf-32le
-16 -1: methodDescriptor
-25 -1: (IJ)Ljava/nio/ByteBuffer;
-18 -1: getSystemResources
-46 -1: (Ljava/lang/String;I)Ljava/util/regex/Pattern;
-46 -1: (Ljava/net/URL;)Lsun/misc/URLClassPath$Loader;
-20 -1: calendars.properties
-25 -1: implOnUnmappableCharacter
-12 -1: signers_name
-40 -1: (ZILjava/util/Locale;)Ljava/lang/String;
-8 -1: (TE;)TE;
-50 -1: ()Lsun/util/locale/provider/LocaleProviderAdapter;
-11 -1: key is null
-7 -1: encrypt
-21 -1: millisUntilExpiration
-55 -1: Unable to parse property sun.reflect.inflationThreshold
-9 -1: checkExit
-5 -1: SHORT
-43 -1: java/util/Collections$UnmodifiableSortedSet
-10 -1: ISO8859_15
-16 -1: verifyParameters
-24 -1: buildAnnotatedInterfaces
-15 -1: refKindIsSetter
-45 -1: (JLjava/util/function/BiConsumer<-TK;-TV;>;)V
-23 -1: (Ljava/lang/Object;IC)V
-90 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-30 -1: (Ljava/net/URL;)Ljava/net/URI;
-60 -1: (BLjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)V
-43 -1: (Ljava/util/Collection;Ljava/lang/Object;)I
-44 -1: (Ljava/net/URLConnection;)Ljava/lang/Object;
-17 -1: Stream not marked
-11 -1: targetCheck
-127 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-11 -1: debugString
-112 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-43 -1: (Ljava/util/Collection;Ljava/lang/Object;)V
-15 -1: NF_staticOffset
-22 -1: CASE_INSENSITIVE_ORDER
-6 -1: unpark
-29 -1: (Ljava/lang/CharSequence;II)I
-59 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-19 -1: defaultFormatLocale
-7 -1: combine
-58 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/BaseLocale;
-29 -1: (Ljava/lang/CharSequence;II)V
-35 -1: sun/util/calendar/BaseCalendar$Date
-57 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
-75 -1: ([Ljava/lang/reflect/Member;[Ljava/lang/String;)[Ljava/lang/reflect/Member;
-15 -1: MethodType_init
-5 -1: (JF)V
-20 -1: AUTOSELECT_FILTERING
-12 -1: invokeStatic
-18 -1: readFileDescriptor
-22 -1: java/lang/Terminator$1
-72 -1: (Ljava/lang/Object;Ljava/util/function/UnaryOperator;)Ljava/lang/Object;
-17 -1: EMPTY_STACK_TRACE
-13 -1: isSamePackage
-32 -1: ()Ljava/security/DomainCombiner;
-10 -1: decodeLoop
-30 -1: DIRECTIONALITY_EUROPEAN_NUMBER
-112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/lang/String;
-33 -1: (Ljava/util/function/Predicate;)Z
-35 -1: logincontext  login context results
-17 -1: sun/nio/cs/UTF_16
-13 -1: SingletonList
-5 -1:  end=
-7 -1: getURLs
-17 -1: traceInstructions
-22 -1: generateCustomizedCode
-9 -1: NO_CHANGE
-11 -1: Number.java
-49 -1: <T:Ljava/lang/Object;>(ITT;)Ljava/util/List<TT;>;
-19 -1: checkSpecifyHandler
-8 -1: setValue
-30 -1: (Ljava/net/URL;)Ljava/net/URL;
-22 -1: (Ljava/lang/Object;C)V
-19 -1: Negative capacity: 
-24 -1: ArrayStoreException.java
-52 -1: (Ljava/lang/StringBuffer;II)Ljava/lang/StringBuffer;
-14 -1: linkMethodImpl
-42 -1: java/util/InvalidPropertiesFormatException
-4 -1: last
-19 -1: getLocalizedMessage
-65 -1: (Ljava/text/MessageFormat;[Ljava/lang/String;)[Ljava/lang/String;
-61 -1: Ljava/lang/Object;Ljava/util/Enumeration<Ljava/lang/Object;>;
-40 -1: (I[CII)Ljava/lang/AbstractStringBuilder;
-27 -1: java.launcher.opt.datamodel
-29 -1: (Ljava/lang/reflect/Method;)V
-19 -1: SPECIFICATION_TITLE
-123 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;ILjava/lang/Class;)Lsun/reflect/SerializationConstructorAccessorImpl;
-32 -1: (I[CII)Ljava/lang/StringBuilder;
-29 -1: (Ljava/lang/reflect/Method;)Z
-23 -1: (Z[B)Ljava/lang/String;
-27 -1: sun/nio/cs/Surrogate$Parser
-32 -1: (Ljavax/security/auth/Subject;)Z
-29 -1: ()Ljava/lang/invoke/Invokers;
-7 -1: getPool
-7 -1: textOut
-12 -1: getEntryTime
-14 -1: classModifiers
-47 -1: (Ljava/util/Locale$Category;)Ljava/util/Locale;
-32 -1: getInheritedAccessControlContext
-4 -1: rcbt
-37 -1: (Ljava/lang/Class<*>;Ljava/io/File;)Z
-25 -1: AccessControlContext.java
-22 -1: FileURLConnection.java
-12 -1: NaturalOrder
-34 -1: sun/util/calendar/CalendarSystem$1
-94 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
-17 -1: No enum constant 
-7 -1: ([DII)V
-8 -1: register
-23 -1: FINAL_QUOTE_PUNCTUATION
-27 -1: ACCESS_CLIPBOARD_PERMISSION
-15 -1: verifyConstants
-20 -1: (Ljava/io/Writer;I)V
-45 -1: (Ljava/lang/String;)Ljava/lang/reflect/Field;
-24 -1: linkMethodHandleConstant
-43 -1: (Ljava/io/OutputStream;Ljava/lang/String;)V
-125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TV;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-14 -1: ALL_PERMISSION
-12 -1: createObject
-10 -1: CRC32.java
-14 -1: reservedMemory
-22 -1: ensureCapacityInternal
-11 -1: FormatData_
-9 -1: maxMemory
-27 -1: (I)Ljava/util/ListIterator;
-8 -1: UTF-16BE
-27 -1: AbstractSequentialList.java
-10 -1: access$400
-16 -1: Locale settings:
-10 -1: access$402
-12 -1: HashSet.java
-24 -1: java/lang/Long$LongCache
-30 -1: [Ljava/lang/reflect/Parameter;
-11 -1: single_step
-45 -1: (Ljava/lang/String;)Lsun/security/util/Debug;
-97 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/SimpleMethodHandle;
-16 -1: indexOfBangSlash
-7 -1: region=
-26 -1: ([BII)Ljava/lang/Class<*>;
-8 -1: bitCount
-3 -1: INT
-67 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/IntFunction<+TT;>;)V
-35 -1: newGetFloatIllegalArgumentException
-11 -1: ([DII[DII)V
-22 -1: makePreparedLambdaForm
-3 -1:  < 
-35 -1: sun/management/GarbageCollectorImpl
-4 -1: (*)*
-7 -1: getPort
-18 -1: java/io/FileSystem
-7 -1: getNode
-38 -1: (Ljava/lang/Object;I)Ljava/lang/Class;
-36 -1: $SwitchMap$java$util$Locale$Category
-18 -1: securityCheckCache
-5 -1: cdate
-10 -1: childValue
-19 -1: getMainClassFromJar
-70 -1: <T:Ljava/lang/Enum<TT;>;>(Ljava/lang/Class<TT;>;Ljava/lang/String;)TT;
-20 -1: unsuspendSomeThreads
-29 -1: sun.classloader.findClassTime
-11 -1: plusSeconds
-3 -1:  = 
-4 -1: Lock
-7 -1: regions
-38 -1: ()Ljava/lang/reflect/Constructor<TT;>;
-25 -1: parseParameterAnnotations
-20 -1: getSystemGMTOffsetID
-33 -1: [Cc][Oo][Dd][Ee][Bb][Aa][Ss][Ee]=
-37 -1: (Ljava/lang/String;I)Ljava/lang/Byte;
-10 -1: permission
-78 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/generics/scope/ConstructorScope;
-28 -1: (Lsun/misc/JavaLangAccess;)V
-26 -1: GET_CLASSLOADER_PERMISSION
-24 -1: (J)Ljava/nio/ByteBuffer;
-20 -1: getUnresolvedActions
-49 -1: (I[BIILsun/security/util/ManifestEntryVerifier;)V
-5 -1: (ZJ)V
-14 -1: isClassOnlyJar
-35 -1: ()[Ljava/util/HashMap$Node<TK;TV;>;
-23 -1: ()Ljava/util/SortedMap;
-29 -1: HistoricallyNamedCharset.java
-30 -1: no leading reference parameter
-8 -1: csCESU-8
-3 -1:  > 
-13 -1: invoke_LLLL_L
-109 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;+TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-13 -1: invoke_LLLL_V
-46 -1: (Ljava/lang/Class;Z)[Ljava/lang/reflect/Field;
-5 -1: offer
-12 -1: isoLanguages
-61 -1: (Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
-44 -1: sun/reflect/BootstrapConstructorAccessorImpl
-12 -1: BaseIterator
-58 -1: (IZ[Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/String;
-23 -1: initializeOSEnvironment
-62 -1: ([Ljava/security/cert/Certificate;)[Ljava/security/CodeSigner;
-3 -1:  >>
-13 -1: searchEntries
-7 -1: setDate
-3 -1: red
-3 -1: ref
-10 -1: EMPTY_LIST
-3 -1: rem
-78 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/List<TE;>;
-9 -1: scanToken
-6 -1: greek8
-9 -1: basicType
-12 -1: getFromClass
-43 -1: averageCharsPerByte exceeds maxCharsPerByte
-8 -1: isDaemon
-7 -1: nonNull
-17 -1: Invalid default: 
-45 -1: (Lsun/misc/URLClassPath;Ljava/lang/String;Z)V
-18 -1: java/lang/String$1
-11 -1: copyMethods
-15 -1: sun/misc/Signal
-5 -1: float
-18 -1: StreamDecoder.java
-19 -1: no such constructor
-14 -1: bad arity for 
-14 -1: divideUnsigned
-10 -1: CODING_END
-3 -1: IST
-14 -1: HeaderIterator
-9 -1: september
-20 -1: makeVarargsCollector
-6 -1: L_PATH
-45 -1: (Ljava/lang/String;)Ljava/io/File$PathStatus;
-24 -1: URI scheme is not "file"
-85 -1: (Ljava/lang/Class<TT;>;Ljava/lang/Class<TV;>;Ljava/lang/String;Ljava/lang/Class<*>;)V
-27 -1: java/util/function/Supplier
-17 -1: checkedCollection
-8 -1: MapEntry
-81 -1: (Ljava/lang/invoke/MethodHandle;ILjava/util/List;)Ljava/lang/invoke/MethodHandle;
-34 -1: java/security/ProtectionDomain$Key
-14 -1: List length = 
-39 -1: ([Ljava/lang/Object;)Ljava/lang/String;
-87 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-7 -1: unparse
-28 -1: jarFileHasClassPathAttribute
-40 -1: (Lsun/misc/JavaIOFileDescriptorAccess;)V
-30 -1: (Ljava/lang/reflect/Field;ZZ)V
-22 -1: GetPropertyAction.java
-8 -1: RUNNABLE
-10 -1: exprString
-13 -1: getAnnotation
-19 -1: class can't be null
-22 -1: defaultAssertionStatus
-8 -1: getName0
-16 -1: quoteReplacement
-15 -1: getMemberVMInfo
-42 -1: (Ljava/lang/Class<*>;)Ljava/lang/Class<*>;
-16 -1: cachedLambdaForm
-16 -1: addFinalRefCount
-12 -1: getMethodAt0
-8 -1: ([ZII)[Z
-44 -1: (Ljava/lang/Object;TV;Ljava/lang/Object;)TV;
-4 -1: [TT;
-29 -1: Ljava/lang/invoke/LambdaForm;
-28 -1: java/util/DualPivotQuicksort
-61 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-17 -1: registerDirectory
-8 -1: jarFiles
-69 -1: (Ljava/lang/CharSequence;[Ljava/lang/CharSequence;)Ljava/lang/String;
-54 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-15 -1: getDefaultValue
-39 -1: sun/util/calendar/ZoneInfoFile$Checksum
-20 -1: DISABLE_JAR_CHECKING
-12 -1: CONTENT_TYPE
-46 -1: array type not assignable to trailing argument
-60 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/stream/Stream<TT;>;
-47 -1: java.lang.invoke.MethodHandle.COMPILE_THRESHOLD
-9 -1: toInstant
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-7 -1: L_ALPHA
-29 -1: java/lang/AbstractMethodError
-29 -1: java/util/jar/Attributes$Name
-15 -1: LOCALE_SETTINGS
-19 -1: (J)Ljava/lang/Long;
-4 -1: jar:
-17 -1: ensureInitialized
-13 -1: LAST_MODIFIED
-40 -1: ([Ljava/lang/String;)[Ljava/lang/String;
-7 -1: shuffle
-70 -1: (Lsun/util/locale/LanguageTag;)Lsun/util/locale/InternalLocaleBuilder;
-19 -1: isPackageAccessible
-17 -1: compileToBytecode
-11 -1: getPackages
-237 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-53 -1: java/util/concurrent/ConcurrentHashMap$KeySpliterator
-26 -1: setURLStreamHandlerFactory
-47 -1: access        print all checkPermission results
-22 -1: sun/reflect/MethodInfo
-75 -1: (Ljava/lang/String;ZLjava/util/Set<Ljava/lang/String;>;)Lsun/misc/Resource;
-6 -1: KOI8-R
-14 -1: Character.java
-5 -1: (SS)I
-8 -1: unshared
-73 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class;
-19 -1: replacementTreeNode
-10 -1: BA_REGULAR
-8 -1: UTF-16LE
-44 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)V
-22 -1: InputStreamReader.java
-17 -1: getInvocationType
-23 -1: getDeclaredConstructors
-48 -1: [Lsun/reflect/generics/tree/FormalTypeParameter;
-67 -1: (Ljava/util/Comparator;Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
-6 -1: koi8_r
-14 -1: ofTotalSeconds
-16 -1: content-encoding
-6 -1: koi8_u
-10 -1: getEncoded
-6 -1: ()[TT;
-43 -1: ([ILjava/util/function/IntUnaryOperator;I)V
-18 -1: getSecurityContext
-13 -1: LF_GEN_LINKER
-78 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-49 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;II)V
-19 -1: LinkedEntryIterator
-23 -1: Warning: JIT compiler "
-7 -1: static 
-100 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Ljava/util/List;
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;)Ljava/util/Collection<TT;>;
-10 -1: iso-ir-100
-10 -1: iso-ir-101
-13 -1: toUpperString
-31 -1: ()Ljava/util/Spliterator$OfInt;
-43 -1: Ljava/lang/StringIndexOutOfBoundsException;
-19 -1: Lsun/misc/JarIndex;
-7 -1: Version
-90 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
-10 -1: getHandler
-45 -1: (ILjava/lang/Object;)Ljava/lang/StringBuffer;
-28 -1: getDeclaredAnnotationsByType
-46 -1: ([Ljava/lang/Class;Ljava/lang/StringBuilder;)V
-53 -1: ()Ljava/util/Enumeration<Ljava/security/Permission;>;
-15 -1: addAllNonStatic
-10 -1: iso-ir-110
-14 -1:     Using VM: 
-17 -1: casReflectionData
-26 -1: (Lsun/util/PreHashedMap;)I
-24 -1: removeByNameAndSignature
-4 -1: OS X
-85 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;Ljava/lang/ClassLoader;Ljava/lang/String;)Z
-16 -1: JarEntryIterator
-38 -1: Ljava/lang/Class<Ljava/lang/Integer;>;
-37 -1: Ljava/lang/Class<Ljava/lang/Double;>;
-28 -1: ([Ljava/util/HashMap$Node;)V
-34 -1: java/lang/reflect/GenericArrayType
-14 -1: annotationData
-26 -1: (Lsun/util/PreHashedMap;)V
-22 -1: checkPackageDefinition
-30 -1: ACCUMULATED_DAYS_IN_MONTH_LEAP
-12 -1: lowestOneBit
-64 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)V
-16 -1: asReadOnlyBuffer
-11 -1: getRealName
-17 -1: StringCoding.java
-10 -1: iso-ir-126
-11 -1: isSurrogate
-8 -1: setError
-138 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
-8 -1: (TK;)TK;
-4 -1: java
-136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)TT;
-36 -1: ()Lsun/util/locale/LocaleExtensions;
-12 -1: doubleStream
-28 -1: ()Ljava/util/SimpleTimeZone;
-7 -1: :@&=+$,
-94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringDecoder;>;>;
-64 -1: (Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
-19 -1: getSystemTimeZoneID
-18 -1: ReentrantLock.java
-8 -1: emptyMap
-16 -1: getSavedProperty
-249 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-14 -1: KeySpliterator
-13 -1: findResources
-14 -1: forWrapperType
-8 -1: floorMod
-12 -1: isoCountries
-10 -1: CheckedSet
-21 -1: AbstractCalendar.java
-12 -1: IS_INVOCABLE
-45 -1: (Ljava/lang/Class;)Lsun/reflect/ConstantPool;
-19 -1: checkSecurityAccess
-13 -1: Invalid index
-28 -1: STACK_TRACE_ELEMENT_SENTINEL
-88 -1: (ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-130 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-14 -1: aliases_IBM437
-10 -1: iso-ir-144
-10 -1: iso-ir-148
-35 -1: ()Ljava/nio/charset/CharsetDecoder;
-95 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-16 -1: UnmodifiableList
-40 -1: ()Ljava/util/concurrent/locks/Condition;
-9 -1: Path.java
-80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/util/Map;
-36 -1: Ljava/lang/Class<Ljava/lang/Float;>;
-124 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;)Ljava/lang/Object;
-20 -1: privateGetParameters
-24 -1: sun/nio/cs/StreamDecoder
-12 -1: getFreeSpace
-8 -1: US-ASCII
-22 -1: negativeZeroDoubleBits
-9 -1: putObject
-13 -1: linkToVirtual
-35 -1: Ljava/lang/Class<Ljava/lang/Long;>;
-15 -1: detectedCharset
-26 -1: java/lang/reflect/Modifier
-22 -1: JAVAFX_LAUNCH_MODE_JAR
-32 -1: java/net/URLStreamHandlerFactory
-7 -1: IBM-923
-80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/String;
-13 -1: TRANSFERINDEX
-34 -1: (Lsun/nio/cs/StandardCharsets$1;)V
-23 -1: ()Ljava/io/InputStream;
-16 -1: ()Ljava/io/File;
-41 -1: (Ljava/lang/String;)Ljava/nio/ByteBuffer;
-22 -1: sun/reflect/Reflection
-23 -1: java/lang/AutoCloseable
-25 -1: BootstrapMethodError.java
-19 -1: EnclosingMethodInfo
-13 -1: transferIndex
-18 -1: java/lang/Compiler
-4 -1: zero
-29 -1: java/util/Arrays$NaturalOrder
-9 -1: language=
-37 -1: Ljava/util/ArrayList<Ljava/net/URL;>;
-73 -1: ()Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;
-16 -1: balanceInsertion
-82 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
-11 -1: asIntBuffer
-27 -1: (Ljava/util/LinkedList;II)V
-13 -1: ofEpochSecond
-19 -1: sunjce_provider.jar
-21 -1: (F)Ljava/lang/String;
-32 -1:  >> does not contain binding << 
-21 -1: declaredPublicMethods
-5 -1: FIELD
-17 -1: getPrimitiveClass
-127 -1: (Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;Ljava/lang/Class;Ljava/lang/String;)V
-21 -1: replaceParameterTypes
-73 -1: Ljava/util/Map<Ljava/lang/Class<*>;Ljava/security/PermissionCollection;>;
-21 -1: (Ljava/lang/Double;)I
-5 -1: floor
-4 -1: halt
-14 -1: newConstructor
-48 -1: (Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)V
-17 -1: packageAccessLock
-15 -1: America/Phoenix
-19 -1: Incoming arguments:
-11 -1: V_Monotonic
-14 -1: decrementExact
-15 -1: updatePositions
-14 -1: toLocaleString
-12 -1: appendEscape
-7 -1: DISPLAY
-27 -1: sun/nio/cs/US_ASCII$Decoder
-13 -1: LITTLE_ENDIAN
-6 -1: isNull
-13 -1: TempDirectory
-6 -1: LM_JAR
-39 -1: JVMTI_THREAD_STATE_WAITING_WITH_TIMEOUT
-10 -1: isCompiled
-36 -1: (Ljava/lang/AbstractStringBuilder;)Z
-3 -1: run
-17 -1: START_PUNCTUATION
-33 -1: Ljava/util/Stack<Ljava/net/URL;>;
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/LambdaForm;
-28 -1: java/security/DomainCombiner
-53 -1: (Ljava/lang/String;Ljava/util/Map;)Ljava/time/ZoneId;
-81 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[Ljava/lang/reflect/AnnotatedType;
-43 -1: java/lang/management/GarbageCollectorMXBean
-11 -1: toTitleCase
-12 -1: getHoldCount
-4 -1: ()[B
-4 -1: ()[C
-4 -1: ()[J
-20 -1: (Ljava/io/File;IZZ)Z
-18 -1: fileTimeToUnixTime
-23 -1: java/nio/HeapCharBuffer
-30 -1: Ljava/lang/ref/ReferenceQueue;
-6 -1: rt.jar
-69 -1: (Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-21 -1: java/lang/ThreadLocal
-25 -1: Ljava/lang/reflect/Field;
-44 -1: (Ljava/lang/String;Ljava/lang/Throwable;ZZ)V
-93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
-22 -1: getDayOfWeekDateBefore
-37 -1: [Lsun/reflect/generics/tree/TypeTree;
-83 -1: <E:Ljava/lang/Object;>(Ljava/util/Map<TE;Ljava/lang/Boolean;>;)Ljava/util/Set<TE;>;
-10 -1: readFields
-42 -1: (Ljava/net/URL;)Ljava/security/CodeSource;
-44 -1: (Ljava/lang/String;IIJ)Ljava/nio/ByteBuffer;
-27 -1: Ljava/util/Collection<TE;>;
-13 -1: checkResource
-7 -1: rename0
-51 -1: (C)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
-47 -1: sun/reflect/generics/repository/FieldRepository
-11 -1: readBoolean
-134 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
-13 -1: getZoneOffset
-17 -1: getJdkVersionInfo
-21 -1: sun/misc/MessageUtils
-23 -1: defaultAllowArraySyntax
-31 -1: java/util/concurrent/locks/Lock
-24 -1: java/lang/reflect/Method
-7 -1: toUpper
-17 -1: sun/misc/Signal$1
-51 -1: (JLjava/util/function/BiFunction<-TK;-TK;+TK;>;)TK;
-28 -1: (Ljava/lang/ref/Reference;)Z
-8 -1: nthreads
-26 -1: MapReduceEntriesToLongTask
-27 -1: (Ljava/util/NavigableSet;)V
-10 -1: savedProps
-25 -1: Lsun/security/util/Debug;
-12 -1: CR_MALFORMED
-13 -1: com.sun.proxy
-17 -1: CharSequence.java
-24 -1: (ILjava/lang/String;II)Z
-13 -1: findNextValue
-108 -1: <K::Ljava/lang/Comparable<-TK;>;V:Ljava/lang/Object;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-5 -1: (FF)F
-9 -1: typeClass
-5 -1: (FF)I
-11 -1: segmentMask
-7 -1: (JJJJ)V
-14 -1: aliases_CESU_8
-85 -1: (Ljava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-15 -1: getCalendarDate
-21 -1: getDeclaredAnnotation
-8 -1: ([BIIB)I
-15 -1: stripExtensions
-14 -1: getISO3Country
-5 -1: short
-47 -1: String value %s exceeds range of unsigned long.
-34 -1: ()Ljava/security/ProtectionDomain;
-8 -1: ([BIIB)V
-23 -1: (Ljava/lang/Object;ID)V
-47 -1: (Ljava/lang/String;Ljava/nio/charset/Charset;)V
-29 -1: RuntimeVisibleTypeAnnotations
-24 -1: (Ljava/io/InputStream;)V
-39 -1: (Ljava/lang/Class;Ljava/lang/String;Z)V
-16 -1: convertPrimitive
-8 -1: (TK;)TV;
-24 -1: (Ljava/io/InputStream;)Z
-6 -1: start 
-243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-9 -1: asSpecial
-20 -1: java/text/Normalizer
-17 -1: DAYS_0000_TO_1970
-9 -1: toCharset
-20 -1: REPLACEALL_THRESHOLD
-20 -1: sun/net/util/URLUtil
-16 -1: findLoadedClass0
-14 -1: localedata.jar
-6 -1: Parser
-6 -1: start0
-4 -1: hash
-83 -1: (Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-29 -1: Ljava/lang/invoke/MemberName;
-8 -1: BOOT_TAG
-22 -1: MH_LINKER_ARG_APPENDED
-14 -1: comparingByKey
-47 -1: ([Ljava/lang/String;)Ljava/lang/ProcessBuilder;
-6 -1: start=
-18 -1: StringBuilder.java
-7 -1: getLong
-12 -1: copyElements
-16 -1: highResFrequency
-11 -1: toGMTString
-10 -1: ISO_8859_1
-10 -1: ISO_8859_2
-6 -1: result
-10 -1: ISO_8859_4
-10 -1: ISO_8859_5
-10 -1: ISO_8859_7
-15 -1: unmodifiableSet
-10 -1: ISO_8859_9
-25 -1: NoClassDefFoundError.java
-42 -1: (Ljava/lang/String;)Ljava/util/LinkedList;
-14 -1: parallelPrefix
-22 -1: ARRAY_LONG_INDEX_SCALE
-6 -1: resume
-36 -1: Ljava/lang/invoke/LambdaForm$Hidden;
-50 -1: java/util/Collections$UnmodifiableRandomAccessList
-130 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Consumer;)V
-6 -1: getInt
-13 -1: getCachedYear
-21 -1: CONNECTOR_PUNCTUATION
-73 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;ILjava/lang/Class;)V
-24 -1: [Lsun/util/calendar/Era;
-22 -1: (Ljava/lang/Object;D)V
-74 -1: (Ljava/security/AccessControlContext;)Ljava/security/AccessControlContext;
-109 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
-6 -1: ([CZ)V
-74 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
-19 -1: TRADITIONAL_CHINESE
-125 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set;)V
-18 -1: unknown protocol: 
-57 -1: (Ljava/lang/reflect/Method;Lsun/reflect/MethodAccessor;)V
-13 -1: writeComments
-9 -1: Negotiate
-14 -1: Closeable.java
-10 -1: asSpreader
-122 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
-17 -1: jvm_minor_version
-9 -1: getDouble
-25 -1: Ljava/io/File$PathStatus;
-19 -1: averageCharsPerByte
-22 -1: getConstructorAccessor
-61 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMBean;
-45 -1: (Ljava/lang/String;)Ljava/util/regex/Pattern;
-25 -1: (JC)Ljava/nio/ByteBuffer;
-20 -1: exclusiveOwnerThread
-85 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)V
-17 -1: getExtensionValue
-14 -1: getLoadAverage
-17 -1: GET_PD_PERMISSION
-6 -1: METHOD
-23 -1: sun/nio/cs/ISO_8859_1$1
-23 -1: (I[Ljava/lang/Object;)I
-4 1: zzz1
-13 -1: createWrapper
-4 1: zzz2
-4 1: zzz3
-33 -1:  greater than Character.MAX_RADIX
-37 -1: DIRECTIONALITY_RIGHT_TO_LEFT_OVERRIDE
-6 -1: BRIDGE
-20 -1: canonicalizeLanguage
-13 -1: setPermission
-46 -1: (Ljava/io/OutputStream;)Ljava/io/OutputStream;
-3 -1: 646
-14 -1: java/lang/Long
-55 -1: java/util/concurrent/ConcurrentHashMap$SearchValuesTask
-38 -1: (IC)Ljava/lang/invoke/LambdaForm$Name;
-37 -1: (Ljava/lang/Class;)Ljava/lang/String;
-17 -1: javaUtilJarAccess
-23 -1: registerMethodsToFilter
-34 -1: (Ljava/nio/charset/Charset;[CII)[B
-11 -1: % VERSION 2
-37 -1: ([DI)Ljava/util/Spliterator$OfDouble;
-16 -1:     Stack Size: 
-52 -1: (Ljava/lang/Class;)Ljava/lang/annotation/Annotation;
-17 -1: putDoubleVolatile
-10 -1: access$500
-10 -1: access$502
-28 -1: malformed input around byte 
-13 -1: LF_INVSPECIAL
-32 -1: Non-positive averageCharsPerByte
-14 -1: NF_fieldOffset
-10 -1: access$508
-48 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/List<TT;>;
-17 -1: defaultReadObject
-17 -1: java/util/TimSort
-13 -1: resolveClass0
-92 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-20 -1: setLangReflectAccess
-30 -1: java/lang/reflect/TypeVariable
-56 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/Spliterator<TT;>;
-8 -1: VOLATILE
-10 -1: Big5-HKSCS
-23 -1: (Ljava/util/Locale$1;)V
-15 -1: ISO_8859-1:1987
-14 -1: no such method
-10 -1: null value
-8 -1: checkURL
-22 -1: ARRAY_BYTE_INDEX_SCALE
-27 -1: (Ljava/lang/ClassLoader;Z)V
-22 -1: java/lang/reflect/Type
-25 -1: java/net/JarURLConnection
-36 -1: java/util/WeakHashMap$KeySpliterator
-26 -1: ()Lsun/misc/JavaAWTAccess;
-50 -1: (I[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-9 -1: toDegrees
-12 -1: lowSurrogate
-19 -1: getEnclosingMethod0
-7 -1: bytearr
-35 -1: (Ljava/util/List;Ljava/util/List;)I
-25 -1: [Ljava/lang/reflect/Type;
-34 -1: javaSecurityProtectionDomainAccess
-21 -1: java.launcher.X.usage
-37 -1: sun/util/locale/InternalLocaleBuilder
-33 -1: ()Ljava/lang/invoke/MethodHandle;
-3 -1: scl
-19 -1: synthesizeAllParams
-68 -1: Ljava/util/Map<Ljava/lang/String;[Ljava/security/cert/Certificate;>;
-6 -1: vclass
-35 -1: (Ljava/util/List;Ljava/util/List;)V
-59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Float;>;
-13 -1: CallSite.java
-10 1: Bar loaded
-21 -1: ARRAY_INT_BASE_OFFSET
-49 -1: Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-32 -1: [Ljava/lang/reflect/Constructor;
-4 -1: type
-34 -1: <T:Ljava/lang/Object;>([TT;II)[TT;
-25 -1: BufferedOutputStream.java
-23 -1: java/util/zip/ZipFile$1
-24 -1: ()Ljava/lang/ClassValue;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[F[FIIII)V
-16 -1: getQueuedThreads
-26 -1: getJavaNetHttpCookieAccess
-8 -1: setExtra
-8 -1: implRead
-20 -1: linkMethod => throw 
-76 -1: (Ljava/util/function/ToDoubleFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-11 -1: KeyIterator
-39 -1: Ljava/util/List<Ljava/lang/Throwable;>;
-3 -1: " "
-36 -1: Ljava/lang/IllegalArgumentException;
-11 -1: checkBounds
-30 -1: sun/nio/cs/FastCharsetProvider
-11 -1: toLongArray
-107 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
-8 -1:  (build 
-39 -1: (Ljava/nio/Buffer;ILjava/nio/Buffer;I)V
-31 -1: [Ljava/lang/reflect/Executable;
-3 -1: set
-21 -1: PhantomReference.java
-41 -1: java/util/Collections$CheckedNavigableMap
-53 -1: Can not make a java.lang.Class constructor accessible
-12 -1: ([CII[CIII)I
-55 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Void;>;
-12 -1: MICROSECONDS
-11 -1: writeBuffer
-52 -1:               and domain that didn't have permission
-37 -1: java/nio/channels/WritableByteChannel
-26 -1: getRawClassTypeAnnotations
-15 -1: putCharVolatile
-33 -1: java/security/InvalidKeyException
-19 -1: Ljava/io/Closeable;
-83 -1: Lsun/util/locale/LocaleObjectCache<Ljava/util/Locale$LocaleKey;Ljava/util/Locale;>;
-10 -1: SetFromMap
-24 -1: JavaFX-Application-Class
-13 -1: asShortBuffer
-10 -1: getReifier
-15 -1: isPositionIndex
-18 -1: SignalHandler.java
-3 -1: JST
-28 -1: (Ljava/io/FileDescriptor;I)I
-28 -1: getStackAccessControlContext
-16 -1: updateByteBuffer
-27 -1: ()Ljava/net/ContentHandler;
-25 -1: (JD)Ljava/nio/ByteBuffer;
-39 -1: ()Lsun/misc/JavaIOFileDescriptorAccess;
-107 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-42 -1: sun/misc/PerfCounter$WindowsClientCounters
-8 -1: addExact
-28 -1: (Ljava/io/FileDescriptor;I)V
-36 -1: ([Ljava/lang/String;)Ljava/util/Map;
-21 -1: ()Ljava/lang/Process;
-4 -1: UTF8
-5 -1: mkdir
-10 -1: transient 
-3 -1: sgp
-15 -1: balanceDeletion
-161 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;)Ljava/lang/Package;
-15 -1: SynchronizedMap
-40 -1: sun.misc.URLClassPath.disableJarChecking
-92 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/io/Serializable;
-17 -1: removeEldestEntry
-35 -1: (I)Ljava/lang/Class$AnnotationData;
-24 -1: Ljava/util/Locale$Cache;
-13 -1: STANDARD_TIME
-17 -1: sun/nio/cs/MS1252
-99 -1: <K:Ljava/lang/Object;>()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
-23 -1: java/util/LinkedHashSet
-9 -1: iso8859_1
-9 -1: iso8859_2
-9 -1: iso8859_4
-66 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)[TA;
-9 -1: iso8859_5
-9 -1: iso8859_7
-9 -1: iso8859_9
-21 -1: Ljava/util/Formatter;
-6 -1: isPath
-21 -1: makeReferenceIdentity
-24 -1: sun/net/ApplicationProxy
-23 -1: ClassCastException.java
-11 -1: MethodArray
-12 -1: SingletonMap
-41 -1: java/util/ArrayPrefixHelpers$CumulateTask
-7 -1: seconds
-20 -1: ClassRepository.java
-14 -1: allocateMemory
-24 -1: java.launcher.jar.error1
-24 -1: java.launcher.jar.error2
-24 -1: java.launcher.jar.error3
-45 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;)Z
-3 -1: sin
-7 -1: (J[II)I
-3 -1: Itr
-18 -1: findBootstrapClass
-10 -1: getElement
-15 -1: ISO_8859-4:1988
-34 -1: newGetLongIllegalArgumentException
-7 -1: pending
-17 -1: isNotContinuation
-6 -1: EXTSIG
-13 -1: searchMethods
-32 -1: Lsun/misc/JavaUtilZipFileAccess;
-33 -1: ([Ljava/lang/reflect/Parameter;)V
-31 -1: defaultUncaughtExceptionHandler
-89 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;)Ljava/nio/file/WatchKey;
-5 -1: ASCII
-28 -1: ()Lsun/reflect/ConstantPool;
-20 -1: isJavaIdentifierPart
-6 -1: EXTSIZ
-34 -1: Lsun/misc/JavaNetHttpCookieAccess;
-34 -1: ClassLoader object not initialized
-7 -1: CHECKED
-16 -1: encodeBufferLoop
-37 -1: (Ljava/time/Instant;)Ljava/util/Date;
-24 -1: (Ljava/util/Map$Entry;)Z
-50 -1: java/util/concurrent/ConcurrentHashMap$KeyIterator
-31 -1: ()[Ljava/lang/ClassValue$Entry;
-31 -1: java/lang/IllegalStateException
-43 -1: (Ljava/lang/Appendable;Ljava/util/Locale;)V
-6 -1: CENVEM
-53 -1: Ljava/util/ArrayList<Lsun/misc/URLClassPath$Loader;>;
-17 -1: getHeaderFieldKey
-71 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Ljava/lang/String;
-6 -1: CENVER
-17 -1: cleanStaleEntries
-9 -1: linkFirst
-57 -1: (Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
-8 -1: val$file
-27 -1: Invalid parameter modifiers
-6 -1: append
-57 -1: ()Lsun/reflect/generics/repository/ConstructorRepository;
-65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask
-39 -1: (Ljava/lang/String;)Ljava/lang/Integer;
-25 -1: lambda$parallelSetAll$191
-25 -1: lambda$parallelSetAll$192
-25 -1: lambda$parallelSetAll$193
-23 -1: INSERTIONSORT_THRESHOLD
-17 -1: java/time/Instant
-25 -1: lambda$parallelSetAll$194
-14 -1: dynamicInvoker
-9 -1: iso646-us
-8 -1: position
-29 -1: java/nio/channels/FileChannel
-27 -1: java/util/stream/Collectors
-64 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable;)Ljava/lang/String;
-10 -1: INDEX_NAME
-15 -1: getCommentBytes
-67 -1: (Ljava/io/FileOutputStream;Ljava/lang/String;)Ljava/io/PrintStream;
-22 -1: privateGetPublicFields
-32 -1: java/util/BitSet$1BitSetIterator
-12 -1: PERF_MODE_RO
-89 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;Z)Ljava/lang/ClassValue$Entry;
-30 -1: java/security/PrivilegedAction
-18 -1: host can't be null
-26 -1: package name can't be null
-12 -1: PERF_MODE_RW
-10 -1: isEnqueued
-18 -1: argSlotToParameter
-37 -1: (II)Ljava/lang/AbstractStringBuilder;
-5 -1: tabAt
-53 -1: (Ljava/lang/Object;)Ljava/lang/AbstractStringBuilder;
-11 -1: PATH_OFFSET
-18 -1: unicodebigunmarked
-15 -1: ConditionObject
-6 -1: KOREAN
-13 -1: isNamePresent
-24 -1: ()Ljava/lang/Class<TE;>;
-14 -1: isStandardTime
-8 -1: ([IIII)I
-9 -1: WeakEntry
-12 -1: javaIOAccess
-17 -1: key can't be null
-129 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/file/Path;>;Ljava/lang/Iterable<Ljava/nio/file/Path;>;Ljava/nio/file/Watchable;
-8 -1:  handler
-8 -1: ([IIII)V
-10 -1: atBugLevel
-18 -1: makeGuardWithCatch
-18 -1: currentLoadedClass
-11 -1: getCodeBase
-67 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;)Ljava/util/List<TT;>;
-12 -1: JarFile.java
-19 -1: (C)Ljava/io/Writer;
-22 -1: createURLStreamHandler
-23 -1: sun/nio/cs/ArrayDecoder
-13 -1: setAccessible
-18 -1: stripOffParameters
-101 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)[Ljava/security/ProtectionDomain;
-18 -1: Ljava/util/Random;
-16 -1: Pacific/Honolulu
-13 -1: useOldMapping
-65 -1: (Ljava/lang/invoke/LambdaForm$NamedFunction;[Ljava/lang/Object;)V
-14 -1: filterArgument
-12 -1: LF_MH_LINKER
-25 -1: isDirectMemoryPageAligned
-49 -1: (Ljava/util/BitSet;)Ljava/util/function/Supplier;
-54 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;TV;)V
-16 -1: java/time/ZoneId
-4 -1: zfot
-18 -1: isSameClassPackage
-6 -1: julian
-8 -1: (TT;)TT;
-22 -1: java/util/jar/Manifest
-7 -1: charOut
-16 -1: getOffsetsByWall
-19 -1: Illegal replacement
-139 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/List<TE;>;Ljava/util/RandomAccess;Ljava/lang/Cloneable;Ljava/io/Serializable;
-96 -1: <T:Ljava/lang/Object;>(Ljava/lang/reflect/Constructor<TT;>;)Ljava/lang/reflect/Constructor<TT;>;
-15 -1: Annotation.java
-24 -1: (Ljava/lang/Class<*>;)[B
-6 -1: CODING
-34 -1: ([Ljava/lang/ClassValue$Entry;II)V
-6 -1: IGNORE
-62 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
-29 -1: specificToGenericStringHeader
-12 -1: helpTransfer
-8 -1: fastTime
-62 -1: (Ljava/net/URLConnection;[Ljava/lang/Class;)Ljava/lang/Object;
-18 -1: Unhandled signal: 
-8 -1: isStrict
-15 -1: ISO_8859-7:1987
-13 -1: getWeekLength
-14 -1: jvmBuildNumber
-40 -1: (Ljava/lang/String;)Ljava/util/Iterator;
-6 -1: short0
-6 -1: short1
-73 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;)TT;
-10 -1: removeNode
-8 -1: setFloat
-18 -1: cspc862latinhebrew
-11 -1: setTimeZone
-34 -1: java/lang/reflect/AccessibleObject
-25 -1: MapReduceKeysToDoubleTask
-25 -1: java/lang/ref/Reference$1
-24 -1: java/nio/HeapByteBufferR
-15 -1: jdkMicroVersion
-117 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)V
-8 -1: (TT;)TV;
-16 -1: Permissions.java
-22 -1: Ljava/util/Comparator;
-17 -1: getDaylightSaving
-25 -1: ([BIILjava/lang/String;)V
-9 -1: stillborn
-11 -1: maxPosition
-28 -1: java/util/ArrayPrefixHelpers
-73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/SortedMap<TK;TV;>;
-14 -1: useCanonCaches
-5 -1: clean
-16 -1: checkPermission2
-34 -1: sun.misc.launcher.useSharedArchive
-13 -1: shutdownHooks
-5 -1: clear
-240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;)TU;
-6 -1: cp1250
-6 -1: cp1251
-6 -1: cp1252
-13 -1: getZipMessage
-6 -1: cp1253
-28 -1: (J)Ljava/lang/ref/Reference;
-6 -1: cp1254
-54 -1: (ILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
-6 -1: cp1257
-10 -1: deepEquals
-17 -1: WRITE_BUFFER_SIZE
-13 -1: copyFromArray
-40 -1: java/util/Collections$ReverseComparator2
-36 -1: sun/reflect/generics/visitor/Reifier
-19 -1: averageBytesPerChar
-13 -1: javaAWTAccess
-6 -1: cp5346
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;
-6 -1: cp5347
-6 -1: cp5348
-6 -1: cp5349
-5 -1: field
-23 -1: ()Ljava/nio/LongBuffer;
-103 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
-37 -1: (I)Ljava/lang/Character$UnicodeBlock;
-11 -1: offsetAfter
-79 -1: Ljava/util/HashMap<Ljava/security/CodeSource;Ljava/security/ProtectionDomain;>;
-27 -1: invocationHandlerReturnType
-17 -1: POSITIVE_INFINITY
-11 -1: maybeRebind
-3 -1: str
-18 -1: setSecurityManager
-9 -1: signature
-18 -1: corrupted jar file
-89 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
-87 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-6 -1: CENATT
-6 -1: cp5350
-12 -1: AF_GETSTATIC
-38 -1: (TE;Ljava/util/LinkedList$Node<TE;>;)V
-8 -1: isLoaded
-6 -1: CENATX
-6 -1: cp5353
-18 -1: Africa/Addis_Ababa
-35 -1: sun/usagetracker/UsageTrackerClient
-11 -1: toUpperCase
-22 -1: java/util/zip/Inflater
-10 -1: iso_8859-1
-10 -1: iso_8859-2
-3 -1: sum
-7 -1: x-Johab
-10 -1: iso_8859-4
-10 -1: iso_8859-5
-85 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;)Ljava/security/AccessControlContext;
-11 -1: activeCount
-49 -1: (Ljava/lang/ClassLoader;Ljava/lang/ClassLoader;)Z
-51 -1: (Ljava/util/List;Ljava/lang/Class;)Ljava/util/List;
-10 -1: iso_8859-7
-19 -1: appendVmErgoMessage
-10 -1: iso_8859-9
-14 -1: getClassLoader
-6 -1: (CJJ)Z
-15 -1: Lsun/misc/Perf;
-7 -1: getTree
-27 -1: Ljava/text/Normalizer$Form;
-11 -1: ISO-2022-JP
-69 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;)Ljava/lang/Object;
-50 -1: java/lang/invoke/DirectMethodHandle$StaticAccessor
-15 -1: fxLauncherClass
-35 -1: (Ljava/net/URL;Ljava/lang/String;)V
-16 -1: getAndAccumulate
-35 -1: (Ljava/net/URL;Ljava/lang/String;)Z
-32 -1: Non-positive averageBytesPerChar
-35 -1: Ljava/lang/Class<Ljava/lang/Void;>;
-15 -1: CLASS_MODIFIERS
-12 -1: checkedQueue
-13 -1: enumConstants
-10 -1: getFactory
-95 -1: Ljava/util/concurrent/ConcurrentMap<TK;Lsun/util/locale/LocaleObjectCache$CacheEntry<TK;TV;>;>;
-13 -1: Africa/Harare
-57 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date;
-11 -1: ISO-2022-KR
-19 -1: $assertionsDisabled
-13 -1: PROXY_PACKAGE
-17 -1: copyFromLongArray
-81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/LinkedHashMap$Entry<TK;TV;>;
-11 -1: checkDelete
-38 -1: sun/management/ManagementFactoryHelper
-7 -1: UTC1900
-20 -1: getBootstrapResource
-23 -1: ()Ljava/lang/Throwable;
-16 -1: CALLER_SENSITIVE
-26 -1: checkSystemClipboardAccess
-32 -1: Can't set default locale to NULL
-16 -1: fxLauncherMethod
-4 -1:  >= 
-8 -1: provider
-9 -1: Finalizer
-78 -1: (Ljava/io/FileDescriptor;ZZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
-13 -1: emptyIterator
-15 -1: getZipFileCount
-21 -1: isJavaIdentifierStart
-9 -1: connected
-11 -1: (ITK;TV;I)V
-16 -1: America/Honolulu
-22 -1: SynchronizedCollection
-28 -1: java/util/zip/ZipConstants64
-29 -1: inheritedAccessControlContext
-29 -1: ()[Ljava/security/CodeSigner;
-85 -1: (JLjava/lang/String;Ljava/lang/String;Ljava/lang/String;Lcom/sun/management/GcInfo;)V
-25 -1: (Ljava/nio/CharBuffer;Z)V
-15 -1: java/io/Console
-101 -1: (Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-9 -1: | resolve
-81 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
-33 -1: (Ljava/nio/charset/Charset;FF[B)V
-49 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
-66 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/io/File;)Ljava/io/File;
-29 -1: ([Ljava/util/HashMap$Node;I)V
-13 -1: filterMethods
-4 -1: jcal
-61 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/Class<*>;
-6 -1: which=
-46 -1: (Ljava/math/BigInteger;)Ljava/math/BigInteger;
-4 -1: date
-18 -1: internalMemberName
-6 -1: (JJI)Z
-30 -1: [Ljava/lang/invoke/LambdaForm;
-60 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
-15 -1: ReservationNode
-42 -1: java/lang/ThreadLocal$ThreadLocalMap$Entry
-6 -1: setIn0
-4 -1: sort
-8 -1: ibm00858
-110 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
-28 -1: Ljava/lang/ClassValue$Entry;
-22 -1: ensureExplicitCapacity
-6 -1: rotate
-14 -1: closeRequested
-30 -1: ([CII)Ljava/lang/StringBuffer;
-10 -1: LM_UNKNOWN
-15 -1: Comparable.java
-13 -1: getByteBuffer
-9 -1: getScheme
-15 -1: done with meta!
-17 -1: checkForTypeAlias
-7 -1: getKeys
-7 -1: SIG_DFL
-30 -1: Ljava/nio/charset/CoderResult;
-16 -1: returnTypesMatch
-19 -1: getClassAccessFlags
-18 -1: JavaNioAccess.java
-9 -1: setDouble
-23 -1: Ljava/util/zip/ZipFile;
-83 -1: (JLjava/util/function/ToIntFunction<-TK;>;ILjava/util/function/IntBinaryOperator;)I
-11 -1: ACCESS_READ
-15 -1: nativeByteOrder
-5 -1: hours
-7 -1: toArray
-7 -1: Encoder
-12 -1: resolveClass
-29 -1: (Ljava/io/FileDescriptor;JJ)V
-14 -1: redefinedCount
-8 -1: getTotal
-11 -1: iso_8859-13
-11 -1: iso_8859-15
-9 -1: expected 
-18 -1: getDeclaredMethods
-11 -1: elementData
-6 -1: intern
-10 -1: countryKey
-6 -1: setInt
-39 -1: Could not create extension class loader
-24 -1: SELF_SUPPRESSION_MESSAGE
-14 -1: argToSlotTable
-42 -1: Ljava/util/HashMap<TE;Ljava/lang/Object;>;
-5 -1:  \t\n\r\x0c
-4 -1: read
-12 -1: Objects.java
-7 -1: aliases
-29 -1: sun/reflect/LangReflectAccess
-6 -1: prefix
-15 -1: superInterfaces
-10 -1: getDoInput
-30 -1: java/nio/CharBufferSpliterator
-6 -1: KOI8_R
-12 -1: Asia/Kolkata
-6 -1: KOI8_U
-6 -1: LOCSIG
-15 -1: UA-Java-Version
-92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
-14 -1: CertificateRep
-17 -1: getSystemResource
-85 -1: (JLjava/util/function/ToLongFunction<-TV;>;JLjava/util/function/LongBinaryOperator;)J
-27 -1: java/lang/reflect/Parameter
-5 -1: quote
-8 -1: not MH: 
-46 -1: java/util/Collections$UnmodifiableCollection$1
-6 -1: putVal
-6 -1: LOCSIZ
-6 -1: Atomic
-3 -1: 737
-38 -1: java/lang/UnsupportedClassVersionError
-27 -1: ()Ljava/lang/StringBuilder;
-41 -1: sun/net/www/protocol/jar/JarURLConnection
-60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
-59 -1: <T:Ljava/lang/Object;>(TT;TT;Ljava/util/Comparator<-TT;>;)I
-54 -1: java/util/concurrent/locks/AbstractOwnableSynchronizer
-7 -1: getHost
-36 -1: (F)Ljava/lang/AbstractStringBuilder;
-69 -1: <U:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;)Ljava/lang/Class<+TU;>;
-4 -1: Form
-103 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;+TV;>;)Ljava/util/SortedMap<TK;TV;>;
-6 -1: spread
-8 -1: addHours
-13 -1: contentEquals
-47 -1: (Ljava/lang/String;Ljava/security/Permission;)V
-12 -1: newCondition
-23 -1: (Ljava/lang/Object;IZ)V
-26 -1: (Ljava/util/LinkedList;I)V
-13 -1: ConstantValue
-18 -1: URLConnection.java
-12 -1: Boolean.java
-75 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/net/URLStreamHandlerFactory;)V
-21 -1: EMPTY_THROWABLE_ARRAY
-153 -1: (Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;Ljava/lang/Class<*>;[Ljava/lang/String;)Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
-18 -1: getUnresolvedCerts
-13 -1: Negative time
-28 -1: java/util/WeakHashMap$KeySet
-8 -1: slashify
-16 -1: isOtherLowercase
-17 -1: putObjectVolatile
-5 -1: ERASE
-12 -1: filterFields
-40 -1: Ljava/lang/ReflectiveOperationException;
-12 -1: VM settings:
-57 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-10 -1: access$600
-11 -1: ] return =>
-13 -1: user.timezone
-23 -1: USER_AGENT_JAVA_VERSION
-27 -1: (Ljava/util/HashMap$Node;)V
-19 -1: filterNTLMResponses
-28 -1: (Lsun/misc/VMNotification;)V
-37 -1: ()[[Ljava/lang/annotation/Annotation;
-45 -1: ()Lcom/sun/management/DiagnosticCommandMBean;
-3 -1: tan
-31 -1: getDirectlyAndIndirectlyPresent
-7 -1: prepend
-35 -1: (I)Lsun/util/calendar/CalendarDate;
-8 -1: val$dirs
-4 -1: test
-28 -1: Non-positive maxCharsPerByte
-83 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map<TK;TV;>;
-12 -1: JAVA_VERSION
-24 -1: ([Ljava/lang/Thread;IZ)I
-70 -1: (Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
-57 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Comparator<-TT;>;)V
-42 -1: (Ljava/lang/Class<*>;[I)Ljava/lang/Object;
-27 -1: java/lang/SecurityManager$1
-32 -1: java/security/SignatureException
-27 -1: java/lang/SecurityManager$2
-4 -1: .jar
-20 -1: parameterAnnotations
-31 -1: DIRECTIONALITY_BOUNDARY_NEUTRAL
-21 -1: hasClassPathAttribute
-17 -1: checkParentAccess
-35 -1: java/security/PermissionsEnumerator
-6 -1: FORMAT
-92 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;)TU;
-3 -1: 775
-11 -1: PROBE_LIMIT
-111 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
-11 -1: AF_PUTFIELD
-22 -1: (Ljava/lang/Object;Z)V
-20 -1: getGenericReturnType
-9 -1: val$extcl
-13 -1: inClassLoader
-37 -1: sun.urlClassLoader.readClassBytesTime
-35 -1: (JLjava/util/function/BiConsumer;)V
-28 -1: getContentHandlerPkgPrefixes
-10 -1: getChannel
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;TT;Ljava/util/Comparator<-TT;>;)I
-16 -1: parseMemberValue
-4 -1: regn
-47 -1: ([Ljava/lang/Object;III)Ljava/util/Spliterator;
-11 -1:  but found 
-6 -1: adjust
-11 -1: isLowerCase
-29 -1: sun/reflect/ReflectionFactory
-98 -1: <E:Ljava/lang/Object;>(Ljava/util/SortedSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/SortedSet<TE;>;
-18 -1: [Ljava/lang/Error;
-5 -1: entry
-14 -1: refreshVersion
-8 -1: (IIIII)V
-22 -1: unmodifiableCollection
-6 -1: putAll
-22 -1: offsetByCodePointsImpl
-26 -1: (Ljava/lang/String;[BII)[C
-46 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;)V
-4 -1: /LF=
-9 -1: Bits.java
-30 -1: [Ljava/util/WeakHashMap$Entry;
-19 -1: getLastModifiedTime
-44 -1: [Ljava/lang/Thread$UncaughtExceptionHandler;
-11 -1: getZoneInfo
-6 -1: lookup
-19 -1: MapReduceValuesTask
-18 -1: isVarargsCollector
-38 -1: java/util/jar/JarFile$JarEntryIterator
-11 -1: getJarIndex
-9 -1: getByName
-42 -1: (Ljava/lang/Object;JLjava/lang/Object;JJ)V
-71 -1: (Ljava/lang/invoke/LambdaForm$Name;I)Ljava/lang/invoke/LambdaForm$Name;
-30 -1: java/net/ContentHandlerFactory
-54 -1: (Ljava/lang/Class<*>;I)Ljava/lang/invoke/MethodHandle;
-12 -1: getSignature
-9 -1: parseLong
-25 -1: DEBUG_METHOD_HANDLE_NAMES
-15 -1: runFinalization
-13 -1: 0000000000000
-28 -1: ()[Ljava/lang/reflect/Field;
-37 -1: ([Ljava/lang/ClassValue$Entry<*>;II)V
-13 -1: gcInfoBuilder
-64 -1: (JLjava/util/function/BiFunction;Ljava/util/function/Consumer;)V
-5 -1: cnfe1
-8 -1: setShort
-28 -1: (C)Ljava/lang/StringBuilder;
-44 -1: (Ljava/nio/LongBuffer;)Ljava/nio/LongBuffer;
-70 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class<*>;
-33 -1: java/lang/TypeNotPresentException
-5 -1: \n    
-20 -1: acquireInterruptibly
-21 -1: (I)Ljava/lang/String;
-24 -1: (Ljava/io/PrintWriter;)V
-16 -1: convertArguments
-32 -1: Ljava/net/MalformedURLException;
-15 -1: linkToInterface
-39 -1: java/lang/Throwable$PrintStreamOrWriter
-10 -1: iso8859_13
-13 -1: hasPrimitives
-10 -1: iso8859_15
-145 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class<*>;)Ljava/lang/invoke/CallSite;
-8 -1: equalPDs
-28 -1: (Ljava/io/FileDescriptor;J)V
-7 -1: newLine
-43 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Class<*>;
-8 -1: addEntry
-30 -1: java/util/WeakHashMap$EntrySet
-14 -1: USE_OLDMAPPING
-39 -1: (Ljava/io/DataInput;)Ljava/lang/String;
-12 -1: LF_EX_LINKER
-27 -1: java/lang/invoke/MethodType
-23 -1: JavaSecurityAccess.java
-23 -1: isLocalOrAnonymousClass
-19 -1: Expanded arguments:
-18 -1: sun/nio/cs/Unicode
-40 -1: ()Ljava/nio/charset/spi/CharsetProvider;
-23 -1: ([BLjava/lang/String;)V
-7 -1: default
-13 -1: highestOneBit
-9 -1: isDefault
-28 -1: (IF)Ljava/lang/StringBuffer;
-31 -1: ()Ljava/util/ListIterator<TE;>;
-4 -1: base
-23 -1: newPermissionCollection
-7 -1: version
-15 -1: Permission.java
-41 -1: java/lang/invoke/LambdaForm$NamedFunction
-8 -1: isQueued
-24 -1: ([Ljava/lang/Class<*>;)I
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask
-16 -1: checkInitialized
-37 -1: java/lang/ClassLoader$ParallelLoaders
-5 -1: ([B)I
-23 -1: Lsun/misc/URLClassPath;
-9 -1: usr_paths
-10 -1: Queue.java
-43 -1: (Ljava/io/File;Ljava/nio/charset/Charset;)V
-64 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MemberName;
-3 -1: tid
-23 -1: JarIndex-Version: 1.0\n\n
-33 -1: (I)Ljava/nio/charset/CoderResult;
-5 -1: ([B)V
-10 -1: isInstance
-25 -1: unmappableCharacterAction
-11 -1: queueLength
-5 -1: ([B)Z
-10 -1: freeMemory
-47 -1: java/util/ArrayPrefixHelpers$DoubleCumulateTask
-52 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)V
-41 -1: Ljava/util/Collections$ReverseComparator;
-16 -1: copyToShortArray
-206 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Z
-38 -1: sun/launcher/LauncherHelper$SizePrefix
-17 -1: ACCESS_PERMISSION
-17 -1: ReverseComparator
-30 -1: ()Ljava/lang/ClassValue$Entry;
-17 -1: AF_PUTSTATIC_INIT
-6 -1: (IIB)I
-19 -1: java/nio/file/Files
-35 -1: (Z)[Ljava/lang/reflect/Constructor;
-20 -1: INVALID_FIELD_OFFSET
-17 -1: initializeHeaders
-10 -1: management
-10 -1: targetType
-61 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)Ljava/util/SortedSet;
-5 -1: ascii
-8 -1: validate
-78 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/Object;>;
-25 -1: sun/nio/cs/UTF_16$Decoder
-36 -1: sun/management/DiagnosticCommandImpl
-24 -1: unmodifiableNavigableMap
-18 -1: canonicalizeScript
-29 -1: Lsun/misc/JavaSecurityAccess;
-74 -1: ([JLjava/util/function/IntToLongFunction;)Ljava/util/function/IntConsumer;
-38 -1: DIRECTIONALITY_LEFT_TO_RIGHT_EMBEDDING
-11 -1: languageTag
-33 -1: java/lang/invoke/VolatileCallSite
-18 -1: setRequestProperty
-6 -1: 0x%02X
-20 -1: (Ljava/lang/Float;)I
-35 -1: (Ljava/nio/charset/CoderResult$1;)V
-24 -1: (Ljava/lang/Object;JJB)V
-21 -1: synchronizedSortedSet
-59 -1: (Ljava/util/function/ToLongFunction;)Ljava/util/Comparator;
-30 -1: av.length == arity: av.length=
-7 -1: $VALUES
-27 -1: RandomNumberGeneratorHolder
-3 -1: tlr
-43 -1: java/util/ArraysParallelSortHelpers$FJFloat
-28 -1: ()[Ljava/io/File$PathStatus;
-26 -1: invalid extra field length
-13 -1: getExtensions
-7 -1: PARAMS0
-7 -1: PARAMS1
-30 -1: [Ljava/lang/invoke/MemberName;
-7 -1: PARAMS2
-31 -1: java/lang/AbstractStringBuilder
-161 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/function/Consumer;)V
-4 -1: repl
-19 -1: ()Ljava/lang/Class;
-24 -1: BufferedInputStream.java
-9 -1: sizeCache
-8 -1: READLINK
-9 -1: metaIndex
-18 -1: getLocalizedObject
-6 -1: filter
-58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
-140 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-24 -1: Ljava/util/HashMap$Node;
-35 -1: (Lsun/nio/cs/FastCharsetProvider;)V
-8 -1: dispatch
-19 -1: sun.stderr.encoding
-130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/util/List<Ljava/lang/String;>;
-51 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView;
-30 -1: sun.reflect.inflationThreshold
-20 -1: MutableCallSite.java
-26 -1: invokeWithArgumentsTracing
-7 -1: getters
-38 -1: ()[Ljava/lang/reflect/TypeVariable<*>;
-46 -1: ([DLjava/util/function/DoubleBinaryOperator;)V
-5 -1: klass
-13 -1: publicMethods
-37 -1: ()[Ljava/lang/reflect/Constructor<*>;
-126 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-6 -1: FJLong
-20 -1: canBeStaticallyBound
-17 -1: getTimezoneOffset
-9 -1: ALL_TYPES
-3 -1: toV
-8 -1: packages
-15 -1: codePointBefore
-10 -1: getCountry
-13 -1: getDSTSavings
-100 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)Lsun/nio/cs/StreamDecoder;
-50 -1: java/util/ArraysParallelSortHelpers$FJFloat$Sorter
-20 -1: hasNonVoidPrimitives
-7 -1: syncAll
-41 -1: domain        dump all domains in context
-59 -1: Ljava/util/Hashtable<Ljava/lang/Integer;Lsun/misc/Signal;>;
-16 -1: ForEachEntryTask
-18 -1: vminfoIsConsistent
-26 -1: (ZLjava/util/Comparator;)V
-9 -1: Lock.java
-31 -1: Lsun/reflect/ReflectionFactory;
-8 -1: (I[BII)I
-23 -1: doesExtendFXApplication
-87 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl
-11 -1: windows-31j
-28 -1: sun/misc/URLClassPath$Loader
-17 -1: getEntryAfterMiss
-47 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)J
-44 -1: Ljava/util/List<Ljava/security/Permission;>;
-10 -1: openStream
-31 -1: Ljava/net/UnknownHostException;
-19 -1: bad reference kind 
-29 -1: ()Ljava/nio/MappedByteBuffer;
-9 -1: H_UPALPHA
-37 -1: (Ljava/util/function/UnaryOperator;)V
-25 -1: FAKE_METHOD_HANDLE_INVOKE
-4 -1: peek
-25 -1: java/util/Hashtable$Entry
-18 -1: getMemberRefInfoAt
-37 -1: Ljava/util/WeakHashMap$Entry<TK;TV;>;
-14 -1: resolvedHandle
-27 -1: ()Ljava/util/Iterator<TV;>;
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
-6 -1: static
-50 -1: (Ljava/net/URLClassLoader;)Lsun/misc/URLClassPath;
-38 -1: (Ljava/lang/Class;)[Ljava/lang/Object;
-41 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)V
-41 -1: java/lang/invoke/WrongMethodTypeException
-5 -1: group
-10 -1: readObject
-13 -1: getParentFile
-14 -1: daylightSaving
-15 -1: eagerValidation
-36 -1: (Ljava/io/File;)Lsun/misc/MetaIndex;
-18 -1: reduceEntriesToInt
-15 -1: INITIAL_ENTRIES
-18 -1: AtomicInteger.java
-7 -1: .length
-128 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/CharBuffer;>;Ljava/lang/Appendable;Ljava/lang/CharSequence;Ljava/lang/Readable;
-6 -1: asList
-21 -1: unmodifiableSortedSet
-22 -1: ([B)Ljava/util/BitSet;
-5 -1: check
-64 -1: (Ljava/util/jar/JarFile;Lsun/misc/MetaIndex;)Lsun/misc/JarIndex;
-35 -1: ()Ljava/nio/charset/CharsetEncoder;
-4 -1: oome
-25 -1: ()Lsun/misc/URLClassPath;
-27 -1: (Ljava/io/FilePermission;)V
-29 -1: IllegalArgumentException.java
-17 -1: jvmSpecialVersion
-21 -1: Ljava/util/ArrayList;
-13 -1: packagePrefix
-27 -1: (Ljava/io/FilePermission;)Z
-11 -1: canonicalID
-82 -1: Ljava/lang/Object;Ljava/util/Comparator<Ljava/lang/String;>;Ljava/io/Serializable;
-24 -1: java.launcher.opt.footer
-13 -1: NativeLibrary
-37 -1: (Ljava/lang/String;J)Ljava/lang/Long;
-16 -1: longBitsToDouble
-6 -1: getKey
-22 -1: (JLjava/lang/String;)V
-14 -1: ensureCapacity
-69 -1: (Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-22 -1: java/lang/Thread$State
-50 -1: ()Ljava/util/Iterator<Ljava/nio/charset/Charset;>;
-4 -1: 7bit
-46 -1: (Ljava/lang/Class<+Ljava/lang/ClassLoader;>;)Z
-76 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/invoke/LambdaForm$Name;
-3 -1: ttb
-12 -1: UTF_16LE_BOM
-9 -1: remainder
-40 -1: ()Lsun/reflect/generics/visitor/Reifier;
-22 -1: [Ljava/lang/Throwable;
-17 -1: EMPTY_ENUMERATION
-13 -1: erasedInvoker
-46 -1: Ljava/nio/charset/IllegalCharsetNameException;
-10 -1: UnicodeBig
-53 -1: ()Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
-12 -1: MAX_EXPONENT
-10 -1: Enumerator
-15 -1: charset decoder
-11 -1: AF_GETFIELD
-12 -1: | getInvoker
-74 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult;
-14 -1: toUnsignedLong
-46 -1: java/lang/invoke/MethodHandleNatives$Constants
-29 -1: java version "1.8.0-internal"
-21 -1: ([Ljava/lang/Class;)I
-16 -1: UPPERCASE_LETTER
-22 -1: newConstantPerfCounter
-6 -1: signum
-9 -1: getField0
-38 -1: java/nio/charset/CoderMalfunctionError
-21 -1: [Ljava/lang/Runnable;
-11 -1: putIfAbsent
-30 -1: java/util/Collections$EmptySet
-22 -1: (I)[Ljava/lang/String;
-34 -1: Ljava/security/SecurityPermission;
-49 -1: ([Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-190 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceEntriesTask;Ljava/util/function/BiFunction;)V
-22 -1: Not an annotation type
-34 -1: java/io/ObjectInputStream$GetField
-50 -1: (Lsun/reflect/FieldInfo;)Ljava/lang/reflect/Field;
-32 -1: Ljava/lang/NoSuchFieldException;
-70 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)Ljava/lang/Object;
-9 -1: mergeSort
-77 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-21 -1: sun/nio/cs/ISO_8859_1
-8 -1: DST_MASK
-21 -1: Ljava/lang/Throwable;
-108 -1: (Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;I)Ljava/lang/Class$ReflectionData<TT;>;
-32 -1: java/util/Arrays$LegacyMergeSort
-59 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/Class<TT;>;>;
-16 -1: parseUnsignedInt
-36 -1: ([D)Ljava/util/Spliterator$OfDouble;
-26 -1: SPECIFY_HANDLER_PERMISSION
-13 -1: primitiveType
-17 -1: threadStartFailed
-21 -1: (J)Ljava/lang/String;
-23 -1: setClassAssertionStatus
-28 -1: java/util/Hashtable$EntrySet
-28 -1: Non-positive maxBytesPerChar
-19 -1: getApplicationClass
-14 -1: SentinelHolder
-15 -1: staticFieldBase
-25 -1: setDefaultRequestProperty
-66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedValueTask
-8 -1: threadID
-9 -1: getFields
-15 -1: LineNumberTable
-38 -1: java/util/Collections$CheckedSortedSet
-14 -1: jdkBuildNumber
-6 -1: divide
-46 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;Z)V
-20 -1: java/lang/Terminator
-92 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/lang/String;Ljava/net/URL;Ljava/util/jar/JarEntry;)V
-6 -1: force0
-10 -1: getThreads
-34 -1: java/util/IllformedLocaleException
-115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/FieldRepository;
-9 -1: testFlags
-11 -1: getLanguage
-36 -1: java/util/function/IntBinaryOperator
-12 -1: Suppressed: 
-10 -1: isMandated
-23 -1: MethodAccessorImpl.java
-28 -1: (Ljava/util/zip/ZipEntry;)[B
-27 -1: Ljava/util/Hashtable$Entry;
-5 -1: table
-10 -1: Short.java
-19 -1: ReferenceQueue.java
-8 -1: setTabAt
-26 -1: ()Lsun/invoke/empty/Empty;
-53 -1: (Ljava/lang/Class;Ljava/lang/String;)Ljava/lang/Enum;
-74 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-19 -1: changeParameterType
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/security/Permission;>;
-23 -1: (Ljava/lang/Object;IF)V
-32 -1: (I)Ljava/util/ListIterator<TE;>;
-6 -1: unread
-12 -1: isSubclassOf
-6 -1: (JJJ)V
-3 -1: Key
-105 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;ITK;TV;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-14 -1: x-utf-16le-bom
-22 -1: ()Ljava/nio/IntBuffer;
-104 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-21 -1: removeFirstOccurrence
-21 -1: sun/misc/DoubleConsts
-23 -1: ()Ljava/util/SortedSet;
-11 -1: getManEntry
-23 -1: URI is not hierarchical
-7 -1: replace
-16 -1: getDisplayScript
-11 -1: ISO_8859-15
-16 -1: permuteArguments
-5 -1: (JI)C
-41 -1: Error decoding percent encoded characters
-22 -1: ([I)Ljava/lang/String;
-31 -1: java/lang/management/ThreadInfo
-9 -1: useCaches
-22 -1: withInternalMemberName
-5 -1: (JI)I
-5 -1: (JI)J
-67 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;
-95 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
-7 -1: release
-56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/String;
-5 -1: (JI)V
-46 -1: (Ljava/util/Iterator;I)Ljava/util/Spliterator;
-18 -1: verifyMemberAccess
-9 -1: warning: 
-23 -1: java/lang/reflect/Field
-67 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)V
-10 -1: SizePrefix
-15 -1: setJavaIOAccess
-6 -1: (JI)[B
-10 -1: ST_FLUSHED
-10 -1: resolution
-9 -1: ST_CODING
-16 -1: sun/misc/Cleaner
-21 -1: (Ljava/lang/Class;)[B
-18 -1: WeakReference.java
-41 -1: (Ljava/util/List;Ljava/util/Comparator;)V
-18 -1: printPropertyValue
-3 -1: 813
-22 -1: setRunFinalizersOnExit
-4 -1: init
-44 -1: ()Ljava/util/Iterator<Ljava/nio/file/Path;>;
-3 -1: 819
-12 -1: listIterator
-8 -1: , arity=
-24 -1: (Ljava/util/ArrayList;)I
-49 -1: (IJLjava/io/FileDescriptor;Ljava/lang/Runnable;)V
-10 -1: principals
-17 -1: x-ISO-2022-CN-CNS
-22 -1: (Ljava/lang/Object;F)V
-14 -1: setReadTimeout
-19 -1: getProtectionDomain
-13 -1: pathSeparator
-12 -1: getAndSetInt
-58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/Locale;
-11 -1: setWritable
-4 -1: perf
-50 -1: ()Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
-6 -1: LOCTIM
-6 -1: status
-11 -1: replaceName
-52 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuffer;
-9 -1: nextToken
-13 -1: dropArguments
-20 -1: RECOGNIZED_MODIFIERS
-14 -1: getInputStream
-9 -1: readFully
-25 -1: (CLjava/nio/CharBuffer;)I
-24 -1: sun/misc/PathPermissions
-10 -1: malformedN
-9 -1: n is null
-19 -1: instanceof Double: 
-13 -1: markSupported
-26 -1: fromMethodDescriptorString
-43 -1: [Ljava/util/concurrent/locks/ReentrantLock;
-17 -1: parseUnsignedLong
-33 -1: Lsun/misc/URLClassPath$JarLoader;
-26 -1: (Ljava/io/OutputStream;I)V
-6 -1: L_DASH
-17 -1: EmptyNavigableMap
-19 -1: CharsetDecoder.java
-18 -1: makeDynamicInvoker
-12 -1: URLUtil.java
-27 -1: ()Ljava/util/Iterator<TT;>;
-9 -1: initTable
-11 -1: getFragment
-7 -1: isLower
-20 -1: getMethodOrFieldType
-29 -1: java/util/function/BiFunction
-10 -1: access$700
-3 -1: 850
-7 -1: UTC2037
-43 -1: java/util/ArraysParallelSortHelpers$FJShort
-9 -1: toSTZTime
-10 -1: access$702
-3 -1: 852
-8 -1: hashCode
-3 -1: 855
-44 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
-3 -1: 857
-3 -1: 858
-5 -1: erase
-55 -1: ()Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;
-47 -1: (Ljava/util/Iterator;JI)Ljava/util/Spliterator;
-38 -1: Ljava/nio/charset/spi/CharsetProvider;
-22 -1: can't deserialize enum
-13 -1: LF_EX_INVOKER
-18 -1: java/text/Collator
-18 -1: Zero length string
-49 -1: <T:Ljava/lang/Object;>()Ljava/util/Iterator<TT;>;
-5 -1: amd64
-12 -1: getNameCount
-7 -1: inCheck
-52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
-53 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuffer;
-21 -1: java/util/WeakHashMap
-8 -1:  throws 
-52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)Z
-55 -1: Ljava/lang/ref/SoftReference<Ljava/util/jar/Manifest;>;
-16 -1: emptyEnumeration
-3 -1: 862
-89 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class;)Ljava/util/List;
-3 -1: 866
-55 -1: Lsun/reflect/generics/repository/ConstructorRepository;
-35 -1: (Ljava/lang/ref/ReferenceQueue$1;)V
-33 -1: java/util/Collections$CheckedList
-18 -1: prefetchReadStatic
-7 -1: (JI[I)I
-78 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)Ljava/lang/ThreadLocal$ThreadLocalMap;
-7 -1: ordinal
-22 -1: FilterInputStream.java
-26 -1: java/util/zip/ZipConstants
-28 -1: JVM cannot find invoker for 
-43 -1: sun/reflect/generics/parser/SignatureParser
-51 -1: (Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)V
-73 -1: (Ljava/util/function/ToIntFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-17 -1: StringBuffer.java
-62 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set;)V
-6 -1: equals
-9 -1: formatter
-3 -1: 874
-35 -1: newGetShortIllegalArgumentException
-74 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult;
-3 -1: ucp
-60 -1: ([Ljava/lang/ClassValue$Entry;I)Ljava/lang/ClassValue$Entry;
-6 -1: create
-17 -1: makeReinvokerForm
-18 -1: csisolatincyrillic
-15 -1: incrementAndGet
-24 -1: maybeInstantiateVerifier
-33 -1: ()Ljava/nio/channels/FileChannel;
-6 -1: class 
-16 -1: getAnnotatedType
-43 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class;
-9 -1: HASH_BITS
-12 -1: placeInCache
-38 -1: java/util/Collections$SynchronizedList
-89 -1: (Ljava/net/URL;Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)Ljava/security/CodeSource;
-22 -1: (Ljava/lang/String;I)B
-20 -1: Ljava/util/TimeZone;
-16 -1: sun.java.command
-28 -1: java/util/WeakHashMap$Values
-10 -1: X-UTF-16BE
-22 -1: (Ljava/lang/String;I)I
-26 -1: java/nio/DirectCharBufferS
-99 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-22 -1: (Ljava/lang/String;I)J
-26 -1: java/nio/DirectCharBufferU
-54 -1: (Ljava/util/function/Supplier;)Ljava/lang/ThreadLocal;
-21 -1: java/util/AbstractSet
-37 -1: (Ljava/lang/String;)Ljava/lang/Short;
-36 -1: Ljava/nio/charset/CoderResult$Cache;
-22 -1: (Ljava/lang/String;I)S
-15 -1: Ljava/util/Map;
-59 -1: (Ljava/lang/reflect/Type;)Ljava/lang/reflect/AnnotatedType;
-22 -1: (Ljava/lang/String;I)V
-10 -1: getAddress
-25 -1: java/nio/DirectIntBufferS
-11 -1: IMPL_LOOKUP
-3 -1: uee
-7 -1: addTime
-37 -1: sun/security/action/GetPropertyAction
-25 -1: java/nio/DirectIntBufferU
-21 -1: javaUtilZipFileAccess
-34 -1: java/util/Collections$CheckedQueue
-11 -1: readResolve
-22 -1: (Ljava/lang/String;I)Z
-11 -1: findVirtual
-63 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/security/util/Debug;
-22 -1: getDeclaredAnnotations
-16 -1: Collections.java
-18 -1: invalid entry size
-49 -1: java/util/concurrent/ConcurrentHashMap$TableStack
-32 -1: java/util/AbstractSequentialList
-4 -1: int0
-16 -1: MAXIMUM_CAPACITY
-53 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-4 -1: int1
-4 -1: int2
-4 -1: int3
-119 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/MethodAccessor;
-7 -1: variant
-39 -1: Lsun/reflect/annotation/AnnotationType;
-11 -1: arrayOffset
-24 -1: ()Ljava/util/LinkedList;
-31 -1: java/lang/ClassCircularityError
-17 -1: java/lang/Package
-10 -1: ccsid00858
-27 -1: java/io/ExpiringCache$Entry
-16 -1: newFieldAccessor
-67 -1: (Ljava/lang/Object;Ljava/util/function/Function;)Ljava/lang/Object;
-99 -1: Lsun/reflect/generics/repository/GenericDeclRepository<Lsun/reflect/generics/tree/ClassSignature;>;
-53 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)V
-53 -1: Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-58 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/stream/Stream<TT;>;
-54 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Z
-8 -1: Kerberos
-29 -1: ()Ljava/nio/channels/Channel;
-12 -1: java_version
-45 -1: (Lsun/reflect/DelegatingMethodAccessorImpl;)V
-10 -1: canConvert
-136 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-26 -1: getDayOfWeekDateOnOrBefore
-7 -1: INVALID
-10 -1: TERMINATED
-41 -1: Ljava/security/cert/CertificateException;
-74 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/String;
-30 -1: [Ljava/lang/invoke/MethodType;
-13 -1: getMethodName
-7 -1: Factory
-34 -1: (Ljava/util/function/BiConsumer;)V
-11 -1: unlinkFirst
-37 -1: lambda$getDeclaredAnnotationsByType$0
-77 -1: (Ljava/nio/ByteBuffer;ILjava/nio/CharBuffer;II)Ljava/nio/charset/CoderResult;
-20 -1: java/util/ArrayDeque
-65 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;J)V
-49 -1: (Ljava/util/ArrayDeque;Ljava/util/ArrayDeque$1;)V
-22 -1: (J)Ljava/time/Instant;
-17 -1: URLClassPath.java
-6 -1: 8859_1
-25 -1: stopRemoteManagementAgent
-6 -1: 8859_2
-17 -1: containsNullValue
-6 -1: 8859_4
-6 -1: 8859_5
-26 -1: (Ljava/nio/ByteBuffer;IC)V
-76 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)Ljava/lang/Thread;
-6 -1: 8859_7
-6 -1: 8859_9
-8 -1: setHours
-9 -1: File.java
-21 -1: isIdentifierIgnorable
-5 -1: ([C)I
-4 -1: (B)I
-10 -1: codesource
-77 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/security/AccessControlContext;)V
-4 -1: (B)J
-6 -1: isFair
-30 -1: java/lang/NullPointerException
-10 -1: IMPL_NAMES
-13 -1: Runnable.java
-26 -1: Ill-formed extension key: 
-17 -1: ()[Ljava/io/File;
-18 -1: javaSecurityAccess
-16 -1: equalsIgnoreCase
-4 -1: (B)V
-5 -1: ([C)V
-25 -1: Ljava/io/FileInputStream;
-14 -1: trackJavaUsage
-20 -1: Ljava/io/FileSystem;
-10 -1: iso_8859_1
-4 -1: (B)Z
-30 -1: java/lang/NoClassDefFoundError
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-19 -1: java/lang/Cloneable
-55 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;I)V
-27 -1: (Ljava/nio/ByteBuffer;IJZ)V
-21 -1: ()Lsun/misc/JarIndex;
-72 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
-64 -1: (Ljava/util/Collection;Ljava/util/Comparator;)Ljava/lang/Object;
-20 -1: invalid entry crc-32
-9 -1: BASECOUNT
-29 -1: java/security/BasicPermission
-52 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/io/File;
-7 -1: ([B[B)Z
-17 -1: EMPTY_ELEMENTDATA
-61 -1: (Ljava/security/PrivilegedExceptionAction;)Ljava/lang/Object;
-49 -1: (ILjava/lang/Class;)Ljava/lang/invoke/MethodType;
-29 -1: sun/reflect/MagicAccessorImpl
-121 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ConstructorRepository;
-6 -1: ([II)I
-40 -1: (Ljava/lang/String;I)Ljava/lang/Integer;
-25 -1: java.content.handler.pkgs
-63 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<Ljava/lang/String;TV;>;>;
-13 -1: parameterList
-6 -1: rebind
-16 -1: isSuperInterface
-6 -1: ([II)V
-14 -1: currentRuntime
-9 -1: BA_EXISTS
-15 -1: END_PUNCTUATION
-15 -1: no such method 
-19 -1: getAndVerifyPackage
-4 -1: wrap
-24 -1: checkAwtEventQueueAccess
-7 -1: ibm-437
-4 -1: open
-47 -1: (Ljava/nio/ByteBuffer;[BI)Ljava/nio/ByteBuffer;
-21 -1: ADDRESS_BITS_PER_WORD
-13 -1: isConstructor
-12 -1: getUseCaches
-27 -1: sun/util/locale/LocaleUtils
-4 -1: koi8
-23 -1: getParameterAnnotations
-9 -1: providers
-57 -1: ([Ljava/lang/Object;Ljava/util/function/BinaryOperator;)V
-24 -1: Lsun/misc/JavaNetAccess;
-22 -1: ([J)Ljava/lang/String;
-7 -1: p-1022$
-6 -1: isType
-63 -1: Ljava/util/Map<Ljava/lang/String;Lsun/util/calendar/ZoneInfo;>;
-21 -1: pageAlignDirectMemory
-18 -1: getManifestDigests
-37 -1: [Ljava/lang/reflect/AccessibleObject;
-7 -1: decrypt
-54 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/HashMap;
-32 -1: lambda$comparingByKey$bbdbfea9$1
-21 -1: hasGenericInformation
-31 -1: java/nio/charset/CharsetEncoder
-15 -1: setTargetNormal
-3 -1: ulp
-18 -1: argumentTypesMatch
-12 -1: getDayOfYear
-8 -1: closeAll
-76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/SoftReference<TV;>;
-6 -1: concat
-9 -1: getLongAt
-16 -1: hasBeenFinalized
-32 -1: [Ljava/util/Hashtable$Entry<**>;
-23 -1: CheckedRandomAccessList
-106 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/net/URI;
-21 -1: defineClassInPackage.
-11 -1: ([III[III)V
-8 -1: toZoneId
-34 -1: SUBCLASS_IMPLEMENTATION_PERMISSION
-55 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater
-8 -1: isDirect
-10 -1: ALL_ACCESS
-12 -1: isRegistered
-29 -1: ForEachTransformedMappingTask
-5 -1: LIJFD
-23 -1: (Ljava/util/TimeZone;)V
-23 -1: (Ljava/util/TimeZone;)Z
-20 -1: java/lang/Appendable
-29 -1: Lsun/util/calendar/Gregorian;
-9 -1: charValue
-8 -1: ONE_HOUR
-38 -1: (Ljava/util/Locale;)Ljava/lang/String;
-7 -1: script=
-10 -1: X-UTF-16LE
-7 -1: ENTRIES
-6 -1: detach
-38 -1: certpath      PKIX CertPathBuilder and
-14 -1: setLanguageTag
-13 -1: isAlphaString
-13 -1: interpretName
-9 -1: dayOfWeek
-88 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
-91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/MethodHandle;
-13 -1: addTypeString
-17 -1: VectorSpliterator
-12 -1: MILLISECONDS
-6 -1: CENCOM
-10 -1: KeySetView
-18 -1: getTargetException
-7 -1: H_ALPHA
-32 -1: sun/util/locale/BaseLocale$Cache
-25 -1: [Ljava/lang/CharSequence;
-7 -1: Builder
-4 -1: left
-19 -1: BootClassPathHolder
-12 -1: publicFields
-11 -1: windows-437
-9 -1: EMPTY_SET
-26 -1: GET_STACK_TRACE_PERMISSION
-6 -1: copyOf
-14 -1: aliases_IBM737
-9 -1: writeLong
-35 -1: (JLjava/util/concurrent/TimeUnit;)Z
-70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/String;>;
-22 -1: getAnnotatedReturnType
-41 -1: (Ljava/lang/String;[BII)Ljava/lang/Class;
-8 -1: ,maxpri=
-29 -1: handleParameterNumberMismatch
-26 -1: ts            timestamping
-11 -1: checkListen
-10 -1: SourceFile
-44 -1: (Ljava/lang/String;)Ljava/util/jar/JarEntry;
-17 -1: weakCompareAndSet
-9 -1: timestamp
-21 -1: (Z)Ljava/lang/String;
-12 -1: doneWithMeta
-20 -1: makeCollectArguments
-52 -1: (JLjava/util/function/BiFunction;)Ljava/lang/Object;
-10 -1: searchKeys
-48 -1: sun/reflect/SerializationConstructorAccessorImpl
-69 -1: (Ljava/lang/reflect/Constructor<*>;)Lsun/reflect/ConstructorAccessor;
-19 -1: ()Lsun/misc/Unsafe;
-11 -1: deepEquals0
-7 -1: GB18030
-13 -1: ValueIterator
-75 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-28 -1: java/util/PropertyPermission
-6 -1: CENCRC
-3 -1: url
-3 -1: L_L
-19 -1: Certificate too big
-33 -1: sun/reflect/DelegatingClassLoader
-16 -1: lambda$stream$57
-11 -1: BitSet.java
-13 -1: sun/misc/Perf
-26 -1: Ljava/util/SimpleTimeZone;
-7 -1: (BBBB)I
-24 -1: sun/misc/FloatingDecimal
-21 -1: sun/util/PreHashedMap
-8 -1: utf-16be
-11 -1: isInherited
-83 -1: (Ljava/util/Properties;Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
-52 -1: (Ljava/lang/Class;Ljava/security/ProtectionDomain;)V
-11 -1: getDoOutput
-18 -1: asVarargsCollector
-22 -1: NoSuchMethodError.java
-18 -1: getStackTraceDepth
-30 -1: (Ljava/io/File;)Ljava/net/URL;
-15 -1: CURRENCY_SYMBOL
-24 -1: Lsun/misc/JavaNioAccess;
-6 -1: NATIVE
-22 -1: Lsun/misc/PerfCounter;
-63 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask
-30 -1:  less than Character.MIN_RADIX
-17 -1: isCallerSensitive
-8 -1: shutdown
-11 -1: STATE_GREEN
-4 -1: next
-10 -1: tryPresize
-16 -1: CONSTRUCTOR_NAME
-3 -1: MAY
-21 -1: java.security.manager
-20 -1: Lsun/misc/Contended;
-16 -1: DISPLAY_LANGUAGE
-6 -1: KeySet
-9 -1: getScript
-3 -1: utc
-17 -1: TRACE_INTERPRETER
-39 -1: (Ljava/lang/Object;I)Ljava/lang/String;
-19 -1: getFieldAtIfLoaded0
-15 -1: methodFilterMap
-54 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Boolean;>;
-45 -1: java/security/cert/Certificate$CertificateRep
-43 -1: (Ljava/lang/String;)Lsun/util/calendar/Era;
-34 -1: java/security/cert/X509Certificate
-19 -1: versionsInitialized
-11 -1: isDirectory
-14 -1: aliases_IBM775
-38 -1: (Ljava/util/function/Consumer<-TE;>;)V
-38 -1: (Ljava/lang/String;)Ljava/util/Locale;
-40 -1: (Ljava/lang/String;Z)Lsun/misc/Resource;
-14 -1: setDefaultZone
-14 -1: highResCounter
-78 -1: (Ljava/lang/ClassValue$Version;Ljava/lang/Object;)Ljava/lang/ClassValue$Entry;
-16 -1: defaultUseCaches
-40 -1: (Ljava/util/zip/ZipFile;)Ljava/util/Map;
-24 -1: isSupplementaryCodePoint
-15 -1: ISO_8859_1.java
-13 -1: multiplyExact
-126 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
-8 -1: classMap
-8 -1: wildcard
-19 -1: getSimpleBinaryName
-17 -1: illegal signature
-14 -1:  == basicType(
-17 -1: ZipConstants.java
-32 -1: [Ljava/lang/VirtualMachineError;
-27 -1: ()Ljava/util/stream/Stream;
-24 -1: (Ljava/lang/Exception;)V
-21 -1: java/util/Enumeration
-13 -1: newSetFromMap
-8 -1: getenv.*
-20 -1: sun/management/Agent
-21 -1: sun/nio/cs/US_ASCII$1
-7 -1: comment
-15 -1: appendAuthority
-11 -1: hasWrappers
-10 -1: dstOffset 
-24 -1: sun/reflect/ConstantPool
-75 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration;
-52 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarVerifier;
-70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Object;>;
-14 -1: previousSetBit
-17 -1: AF_GETSTATIC_INIT
-15 -1: ArrayDeque.java
-7 -1: boolean
-25 -1: (I)Ljava/math/BigInteger;
-146 -1: (Ljava/lang/ref/ReferenceQueue<Ljava/lang/Class<*>;>;Ljava/util/concurrent/ConcurrentMap<+Ljava/lang/ref/WeakReference<Ljava/lang/Class<*>;>;*>;)V
-8 -1: getClass
-8 -1: user.dir
-6 -1: VALUES
-5 -1: raise
-39 -1: (JLjava/util/function/Consumer<-TV;>;)V
-107 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TT;TV;>;
-5 -1: print
-8 -1: readChar
-55 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
-56 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysTask
-60 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Double;>;
-102 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;)Ljava/util/SortedMap<TK;TV;>;
-23 -1: printModifiersIfNonzero
-14 -1: getterFunction
-15 -1: ISO-10646-UCS-2
-14 -1: canonizeString
-13 -1: getTotalSpace
-24 -1: synchronizedNavigableSet
-100 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;)TT;
-4 -1: ioex
-24 -1: ()Ljava/nio/FloatBuffer;
-14 -1: toBinaryString
-7 -1: Segment
-34 -1: ()Lsun/misc/JavaUtilZipFileAccess;
-17 -1: setTargetVolatile
-22 -1: (Ljava/util/List<*>;)V
-51 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuffer;
-22 -1: (Ljava/util/List<*>;)Z
-5 -1: (FI)F
-11 -1: parseMethod
-8 -1: Compiled
-19 -1: java/util/SortedMap
-7 -1: setByte
-12 -1: getFieldType
-8 -1: pageSize
-14 -1: getCallerClass
-9 -1: ensureObj
-18 -1: refKindHasReceiver
-10 -1: getZoneIds
-24 -1: (Ljava/nio/CharBuffer;)I
-47 -1: ()Lsun/reflect/generics/parser/SignatureParser;
-8 -1: getIndex
-24 -1: (Ljava/lang/Thread;TT;)V
-18 -1: (Ljava/util/Map;)V
-18 -1: (Ljava/util/Map;)Z
-6 -1: random
-10 -1: putAddress
-64 -1: (Ljava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
-24 -1: (Ljava/nio/CharBuffer;)V
-8 -1: canCache
-24 -1: (Ljava/nio/CharBuffer;)Z
-9 -1: getIntAt0
-4 -1: sqrt
-8 -1: makeLong
-54 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)V
-5 -1: (JJ)I
-26 -1: javaIOFileDescriptorAccess
-5 -1: (JJ)J
-15 -1:  != basicType: 
-36 -1: Ljava/lang/ref/ReferenceQueue<-TT;>;
-5 -1: words
-16 -1: sun.jnu.encoding
-32 -1: (Ljava/lang/invoke/LambdaForm;)V
-22 -1: ensureClassInitialized
-16 -1: Ljava/util/List;
-14 -1: varargsInvoker
-5 -1: (JJ)V
-20 -1: java/util/Properties
-12 -1: getImplClass
-21 -1: argumentTypesToString
-5 -1: (JJ)Z
-50 -1: java/util/Collections$SynchronizedRandomAccessList
-17 -1: makeWrappedMember
-21 -1: UnmodifiableSortedSet
-22 -1: (ILjava/lang/Class;Z)V
-3 -1: MIT
-13 -1: bootClassPath
-50 -1: (JLjava/util/function/Function;)Ljava/lang/Object;
-74 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap$Node<TK;TV;>;
-45 -1: (Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
-12 -1: advanceProbe
-10 -1: encoderFor
-14 -1: DataInput.java
-16 -1: java/lang/Double
-3 -1: 912
-3 -1: 914
-3 -1: abs
-3 -1: 915
-13 -1: currentThread
-17 -1: ClassDefiner.java
-32 -1: sun/misc/Launcher$ExtClassLoader
-16 -1: Current state = 
-12 -1: elementCount
-10 -1: unmaskNull
-8 -1: csibm857
-32 -1: java/net/UnknownServiceException
-10 -1: x-utf-16be
-3 -1: acc
-37 -1: Ljava/util/List<Ljava/io/Closeable;>;
-23 -1: ([Ljava/lang/Thread;Z)I
-17 -1: impliesIgnoreMask
-23 -1: getGenericComponentType
-51 -1: ()Lsun/reflect/generics/repository/ClassRepository;
-34 -1: " not found. Will use interpreter.
-38 -1: ()Ljava/security/AccessControlContext;
-6 -1: final 
-8 -1: utf-16le
-3 -1: 920
-3 -1: 923
-5 -1: (I)[C
-43 -1: (Ljava/nio/ByteOrder;)Ljava/nio/ByteBuffer;
-8 -1: csibm862
-34 -1: (Ljava/lang/ref/Reference<+TT;>;)Z
-8 -1: csibm866
-20 -1: getParameterizedType
-7 -1: (II[C)V
-20 -1: [Ljava/lang/Package;
-84 -1: (Ljava/lang/String;Ljava/security/ProtectionDomain;)Ljava/security/ProtectionDomain;
-28 -1: SynchronizedRandomAccessList
-18 -1: sun/misc/VMSupport
-61 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry
-3 -1: add
-16 -1: ZipEntryIterator
-11 -1: next_target
-87 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class<*>;
-4 -1: amod
-12 -1: markedSkipLF
-55 -1: java/util/concurrent/ConcurrentHashMap$EntrySpliterator
-5 -1:  lim=
-29 -1: java/security/PermissionsHash
-50 -1: (Ljava/lang/CharSequence;II)Ljava/lang/Appendable;
-19 -1: makePairwiseConvert
-58 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)V
-8 -1: contents
-11 -1: user.region
-17 -1: RandomAccess.java
-13 -1: singletonList
-13 -1: policy,access
-64 -1: Ljava/util/Map<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;
-25 -1: (Ljava/lang/Appendable;)V
-19 -1: (Ljava/util/List;)V
-43 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class;)V
-19 -1: (Ljava/util/List;)Z
-15 -1: America/Chicago
-25 -1: (II)Ljava/nio/CharBuffer;
-12 -1: getDayOfWeek
-8 -1: ([BIIZ)V
-28 -1: (Ljava/lang/reflect/Field;)I
-28 -1: (Ljava/lang/reflect/Field;)J
-18 -1: getDeclaringClass0
-11 -1: counterTime
-30 -1: (Ljava/util/Collection<TE;>;)V
-28 -1: (Ljava/lang/reflect/Field;)V
-31 -1: (IIIILjava/io/FileDescriptor;)V
-25 -1: java/net/SocketPermission
-20 -1: bad parameter count 
-18 -1: getHeaderFieldLong
-26 -1: GetReflectionFactoryAction
-19 -1: MIN_TRANSFER_STRIDE
-17 -1: java/nio/Bits$1$1
-7 -1: getSize
-33 -1: java/util/function/ToLongFunction
-46 -1: (IILjava/lang/String;)Ljava/lang/StringBuffer;
-10 -1: access$800
-65 -1: sun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache
-26 -1: (Ljava/lang/ClassLoader;)V
-25 -1: java/util/IdentityHashMap
-26 -1: (Ljava/lang/ClassLoader;)Z
-91 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-26 -1: ([CIILjava/lang/String;I)I
-12 -1: canonicalize
-3 -1: val
-8 -1: putCharB
-12 -1: UTF_32LE_BOM
-60 -1: (Ljava/security/CodeSource;)Ljava/security/ProtectionDomain;
-44 -1: (Lsun/misc/SignalHandler;Lsun/misc/Signal;)V
-26 -1: (Ljava/util/Enumeration;)V
-11 -1: INVALIDATED
-8 -1: putCharL
-22 -1: (II)Ljava/lang/String;
-7 -1: hasNext
-5 -1: WRITE
-20 -1: MIN_INITIAL_CAPACITY
-13 -1: propertyNames
-9 -1: Gregorian
-13 -1: getExpiration
-7 -1: minutes
-7 -1: ostream
-9 -1: java.lang
-17 -1: forceStandardTime
-9 -1: initWords
-41 -1: java/lang/Thread$UncaughtExceptionHandler
-9 -1: theUnsafe
-27 -1: ForEachTransformedEntryTask
-10 -1: forEncoder
-31 -1: needsClassLoaderPermissionCheck
-5 -1: ctime
-25 -1: ()Ljava/nio/DoubleBuffer;
-8 -1: getValue
-66 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale$Key;
-42 -1: (Ljava/io/InputStream;Ljava/lang/String;)V
-6 -1: august
-14 -1: compileClasses
-13 -1: javaNetAccess
-22 -1: interpretWithArguments
-4 -1: url:
-14 -1: EMPTY_ITERATOR
-60 -1: Ljava/util/WeakHashMap<Ljava/io/Closeable;Ljava/lang/Void;>;
-24 -1: java/util/jar/Attributes
-12 -1: getOrDefault
-19 -1: Pacific/Guadalcanal
-33 -1: ()Ljava/lang/reflect/Constructor;
-38 -1: java/util/Collections$UnmodifiableList
-13 -1: basicTypeChar
-22 -1: (Ljava/lang/String;J)J
-14 -1: memberDefaults
-42 -1: (Ljava/lang/Class<*>;[Ljava/lang/String;)V
-38 -1: (Ljava/util/function/Consumer<-TK;>;)V
-16 -1: LF_NEWINVSPECIAL
-10 -1: classDepth
-28 -1: [Ljava/io/ObjectStreamField;
-46 -1: (Ljava/util/Collection;)Ljava/util/Collection;
-91 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
-11 -1: getLocation
-39 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)V
-9 -1: loadTable
-55 -1: Directory separator should not appear in library name: 
-7 -1: setTime
-14 -1: getConstructor
-4 -1: urls
-25 -1: dispatchUncaughtException
-77 -1: (ILjava/lang/Object;Ljava/lang/Class<*>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-8 -1: modCount
-8 -1: Opening 
-6 -1: ENDHDR
-4 -1: cnfe
-34 -1: DIRECTIONALITY_PARAGRAPH_SEPARATOR
-10 -1: Asia/Amman
-3 -1: MST
-28 -1: DIRECTIONALITY_ARABIC_NUMBER
-3 -1: all
-4 -1: enum
-8 -1: copyWith
-12 -1: ([JI[IIJII)I
-29 -1: Ljava/lang/annotation/Target;
-7 -1: Thread-
-14 -1: x-utf-32le-bom
-38 -1: (ILjava/lang/management/MemoryUsage;)V
-33 -1: Signal already used by VM or OS: 
-27 -1: (I)Ljava/lang/StringBuffer;
-25 -1: java/text/Normalizer$Form
-10 -1: x-utf-16le
-34 -1:  can not access a member of class 
-27 -1: (Ljava/nio/ByteBuffer;IFZ)V
-28 -1: (Ljava/lang/ClassValue<*>;)V
-16 -1: INITIAL_CAPACITY
-23 -1: DirectMethodHandle.java
-18 -1: reduceValuesToLong
-41 -1: (Ljava/lang/String;Ljava/lang/Class<*>;)V
-6 -1: unwrap
-12 -1: threadStatus
-5 -1: (DI)D
-11 -1: fieldOffset
-52 -1: java/util/concurrent/ConcurrentHashMap$EntryIterator
-14 -1: ACCESS_EXECUTE
-44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/CharBuffer;
-29 -1: ([Ljava/lang/ThreadGroup;IZ)I
-18 -1: LocalVariableTable
-17 -1: ConstantPool.java
-26 -1: (Ljava/nio/ByteBuffer;ID)V
-4 -1: (C)B
-3 -1: and
-4 -1: head
-126 -1: (Ljava/lang/reflect/GenericDeclaration;Lsun/reflect/generics/scope/Scope;)Lsun/reflect/generics/factory/CoreReflectionFactory;
-4 -1: (C)C
-16 -1: Pacific/Auckland
-7 -1: Thread[
-5 -1: ([D)I
-4 -1: (C)I
-98 -1: <U:Ljava/lang/Object;>([Ljava/lang/reflect/Constructor<TU;>;)[Ljava/lang/reflect/Constructor<TU;>;
-11 -1: fileHandler
-30 -1: DIRECTIONALITY_NONSPACING_MARK
-10 -1: (this Map)
-14 -1: malformedCache
-5 -1: ([D)V
-4 -1: (C)V
-26 -1: getUnicodeLocaleAttributes
-4 -1: (C)Z
-81 -1: (JLjava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)J
-46 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node;
-20 -1:     Max. Heap Size: 
-24 -1: Ljava/lang/reflect/Type;
-13 -1: EmptyIterator
-8 -1: allocate
-7 -1: FLUSHED
-8 -1: exitVM.*
-59 -1: (Ljava/lang/String;)Lsun/util/locale/InternalLocaleBuilder;
-19 -1: reduceEntriesToLong
-15 -1: getISOLanguages
-13 -1: CONSTANT_ZERO
-23 -1: (I)Ljava/util/Iterator;
-96 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
-11 -1: isSynthetic
-7 -1: lineBuf
-30 -1: java/lang/annotation/Inherited
-65 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/lang/Iterable<TE;>;
-35 -1: (Ljava/lang/String;)[Ljava/io/File;
-27 -1: java/security/cert/CertPath
-26 -1: startRemoteManagementAgent
-9 -1: shiftLeft
-5 -1: stack
-42 -1: (Ljava/lang/Class<*>;[Ljava/lang/Object;)V
-11 -1: CheckedList
-10 -1: replaceAll
-86 -1: (Ljava/util/HashMap$TreeNode;Ljava/util/HashMap$TreeNode;)Ljava/util/HashMap$TreeNode;
-24 -1: (I)Ljava/nio/CharBuffer;
-13 -1: image/vnd.fpx
-15 -1: iso_8859-1:1987
-19 -1: (Ljava/lang/Long;)I
-22 -1: sun/misc/SignalHandler
-15 -1: ifModifiedSince
-42 -1: (Ljava/lang/Class;)Ljava/lang/ClassLoader;
-105 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class;I[Ljava/lang/invoke/MemberName;)I
-22 -1: Negative timeout value
-38 -1: Ljava/io/UnsupportedEncodingException;
-11 -1: removeRange
-13 -1: Compiler.java
-6 -1: Sorter
-8 -1: aliasSet
-10 -1: UNASSIGNED
-34 -1: lambda$comparingByValue$1065357e$1
-34 -1: ()Ljava/lang/Class$AnnotationData;
-25 -1: sun/misc/Launcher$Factory
-15 -1: getLongVolatile
-8 -1: vmloader
-10 -1: unicodebig
-10 -1: closeables
-31 -1: JavaIOFileDescriptorAccess.java
-7 -1:  static
-3 -1: arg
-21 -1: library can't be null
-42 -1: java/util/ArraysParallelSortHelpers$FJByte
-22 -1: getDeclaringExecutable
-19 -1: runFinalizersOnExit
-20 -1: simpleTimeZoneParams
-13 -1: Modifier.java
-14 -1: pkcs11keystore
-6 -1: shared
-30 -1: java/net/MalformedURLException
-26 -1: ()[Lsun/util/calendar/Era;
-13 -1: x-MS950-HKSCS
-10 -1: relativize
-40 -1: (Ljava/lang/String;JJ)Ljava/lang/String;
-31 -1: java/util/HashMap$ValueIterator
-29 -1: MODIFY_THREADGROUP_PERMISSION
-38 -1: (Ljava/lang/String;)Ljava/lang/Object;
-7 -1: destroy
-37 -1: (Ljava/util/List;)[Ljava/lang/String;
-18 -1: (Ljava/io/File;Z)V
-32 -1: Ljava/util/HashMap$Node<TK;TV;>;
-18 -1: interfaceModifiers
-34 -1: java/util/LinkedList$LLSpliterator
-7 -1: REF_???
-23 -1: java/net/ContentHandler
-20 -1: <compiledLambdaForm>
-17 -1: [Ljava/lang/Byte;
-6 -1: exitVM
-3 -1: att
-27 -1: sun/nio/cs/UTF_16BE$Encoder
-6 -1: exists
-28 -1: Ljava/util/Collection<+TE;>;
-48 -1: (Ljava/lang/CharSequence;)Ljava/lang/Appendable;
-6 -1: getMap
-52 -1: ([Ljava/lang/Class;I)Ljava/lang/reflect/Constructor;
-11 -1: stackTrace[
-21 -1: slowCheckMemberAccess
-33 -1: ReflectiveOperationException.java
-9 -1: versionId
-56 -1: Wrong number of parameters in MethodParameters attribute
-14 -1: isLowSurrogate
-8 -1: csPCp852
-16 -1: copyConstructors
-25 -1: ()Ljava/util/Spliterator;
-9 -1: closeLock
-17 -1: readUnsignedShort
-7 -1: 8859_13
-7 -1: 8859_15
-13 -1: TARGET_OFFSET
-26 -1: (Ljava/util/Hashtable;IZ)V
-44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/CharBuffer;
-46 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class<*>;
-25 -1: DEFAULT_CONCURRENCY_LEVEL
-36 -1: Ljava/util/List<Ljava/lang/String;>;
-29 -1: sun.nio.PageAlignDirectMemory
-37 -1: (Ljava/lang/Class;I)Ljava/lang/Class;
-12 -1: encryptBlock
-8 -1: parentOf
-5 -1: H_HEX
-11 -1: getFloatAt0
-24 -1: VirtualMachineError.java
-18 -1: getDeclaredClasses
-59 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/StringBuffer;
-42 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[C
-37 -1: (Ljava/lang/String;)Ljava/lang/Float;
-13 -1: Iterator.java
-25 -1: (Ljava/io/PrintStream;I)V
-9 -1: getObject
-19 -1: [Ljava/lang/String;
-7 -1: SIZECTL
-11 -1: isUnderflow
-27 -1: sun.nio.MaxDirectMemorySize
-21 -1: isNonPublicProxyClass
-13 -1: toCalendarDOW
-9 -1: Type.java
-14 -1: aliases_IBM850
-17 -1: emptyNavigableMap
-14 -1: aliases_IBM852
-14 -1: aliases_IBM855
-14 -1: aliases_IBM857
-14 -1: aliases_IBM858
-15 -1: iso_8859-4:1988
-13 -1: UnicodeScript
-8 -1: getCharB
-17 -1: constructorMethod
-27 -1: java/util/function/Function
-20 -1: getProtectionDomain0
-8 -1: getCharL
-32 -1: ([Ljava/io/File;)[Ljava/net/URL;
-51 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodHandle;
-7 -1: getenv.
-5 -1: stale
-14 -1: aliases_IBM862
-32 -1: java/util/spi/LocaleNameProvider
-14 -1: aliases_IBM866
-51 -1: ([Ljava/lang/Class;)Ljava/lang/reflect/Constructor;
-6 -1: CENDSK
-36 -1: java/util/Comparators$NullComparator
-34 -1: UnsafeStaticFieldAccessorImpl.java
-17 -1: staticFieldOffset
-12 -1: prefetchRead
-4 -1: help
-34 -1: (Ljava/util/concurrent/TimeUnit;)J
-8 -1: getChars
-19 -1: java/lang/Throwable
-34 -1: Annotation Type:\n   Member types: 
-55 -1: (Ljava/lang/Class<*>;Ljava/security/ProtectionDomain;)V
-14 -1: aliases_IBM874
-17 -1: getDisplayVariant
-24 -1: Ljava/net/NetPermission;
-15 -1: jvmMinorVersion
-11 -1: subSequence
-3 -1: x86
-6 -1: double
-14 -1: checkSlotCount
-20 -1: java/net/InetAddress
-14 -1: Principal.java
-8 -1: $,;:@&=+
-17 -1: ByteBuffered.java
-21 -1: sun.misc.Perf.getPerf
-11 -1: finishEntry
-27 -1: sun.timezone.ids.oldmapping
-26 -1: (ZLjava/io/OutputStream;)V
-41 -1: (Ljava/lang/String;Z)Ljava/lang/Class<*>;
-32 -1: generateSerializationConstructor
-6 -1: Value 
-40 -1: (Ljava/lang/String;Ljava/lang/String;Z)V
-16 -1: previousClearBit
-7 -1: theProp
-51 -1: (Ljava/io/OutputStream;Ljava/nio/charset/Charset;)V
-39 -1: com.sun.javafx.application.LauncherImpl
-21 -1: URLStreamHandler.java
-4 -1:  in 
-14 -1: BIT_INDEX_MASK
-125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TK;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-49 -1: (Ljava/util/Set;Ljava/lang/Class;)Ljava/util/Set;
-10 -1: scaleValue
-27 -1: (Ljava/nio/ByteBuffer;IDZ)V
-78 -1: (Ljava/util/Collection<Ljava/lang/reflect/Field;>;[Ljava/lang/reflect/Field;)V
-53 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Enumeration<TT;>;
-38 -1: java/lang/IncompatibleClassChangeError
-60 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask
-23 -1: not a method or field: 
-35 -1: Ljava/nio/BufferUnderflowException;
-4 -1: i386
-13 -1: US_ASCII.java
-80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/reflect/AnnotatedType;
-21 -1: initializeSystemClass
-6 -1: ([CI)I
-18 -1: getBooleanProperty
-35 -1: java/util/function/ToDoubleFunction
-37 -1: (Ljava/lang/String;)Ljava/lang/Class;
-28 -1: MapReduceEntriesToDoubleTask
-38 -1: java/util/LinkedHashMap$LinkedEntrySet
-8 -1: copySign
-6 -1: ([CI)V
-55 -1: sun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule
-12 -1: parseBoolean
-3 -1: NET
-3 -1: NEW
-6 -1: Values
-17 -1: getJavaLangAccess
-9 -1: LocaleKey
-3 -1: :-1
-30 -1: (Ljava/io/ObjectInputStream;)V
-3 -1: NFC
-3 -1: NFD
-18 -1: SIMPLIFIED_CHINESE
-28 -1: ()Ljava/lang/reflect/Method;
-9 -1: localInit
-37 -1: sun/util/locale/LocaleSyntaxException
-15 -1: LambdaForm.java
-5 -1: rtype
-8 -1:  field "
-50 -1: (Ljava/lang/Class;Ljava/lang/ref/ReferenceQueue;)V
-80 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)V
-36 -1: java/lang/invoke/MethodHandleNatives
-22 -1: (Ljava/util/Map<**>;)Z
-22 -1: Ljava/lang/Class<TV;>;
-7 -1: SubList
-14 -1: connect,accept
-19 -1: declaredAnnotations
-38 -1: Ljava/lang/ThreadLocal$ThreadLocalMap;
-11 -1: isSpaceChar
-10 -1: offerFirst
-20 -1: sun/nio/ByteBuffered
-17 -1: packageDefinition
-7 -1: trigger
-35 -1: [Ljava/lang/invoke/LambdaForm$Name;
-19 -1: sun.stdout.encoding
-5 -1: start
-26 -1: (Ljava/util/HashMap;IIII)V
-65 -1: (JLjava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
-6 -1: LOCVER
-3 -1: ://
-42 -1: (CLjava/lang/Class<*>;Ljava/lang/Object;)Z
-6 -1: friday
-45 -1: sun/reflect/DelegatingConstructorAccessorImpl
-15 -1: iso_8859-7:1987
-15 -1: newCalendarDate
-24 -1: getAnnotatedReceiverType
-32 -1: java/util/NoSuchElementException
-50 -1: (Ljava/util/NavigableSet;)Ljava/util/NavigableSet;
-26 -1: java/text/SimpleDateFormat
-16 -1: threadInitNumber
-55 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Spliterator<TT;>;
-23 -1: (Ljava/lang/Object;)TT;
-3 1: bar
-37 -1: getFunctionalInterfaceMethodSignature
-5 -1: state
-39 -1: [Ljava/lang/reflect/GenericDeclaration;
-22 -1: sun/net/ProgressSource
-13 -1: LLSpliterator
-93 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Enumeration<TT;>;Ljava/util/Iterator<TT;>;
-5 -1: JAPAN
-11 -1: SPACE_TOTAL
-20 -1: CharsetProvider.java
-12 -1: CR_UNDERFLOW
-7 -1: ITALIAN
-11 -1: getCallerPD
-13 -1: isMemberClass
-38 -1: (Ljava/util/function/Consumer<-TT;>;)V
-18 -1: malformedForLength
-14 -1: ReflectionData
-34 -1: (BZI)Ljava/lang/invoke/LambdaForm;
-16 -1: forPrimitiveType
-31 -1:  field found in java.lang.Class
-60 -1: (Ljava/lang/Void;Ljava/lang/ThreadGroup;Ljava/lang/String;)V
-18 -1: DescendingIterator
-25 -1: (IZLjava/lang/Runnable;)V
-35 -1: ()[Ljava/lang/reflect/TypeVariable;
-3 -1: bcp
-23 -1: (Ljava/lang/Object;)TV;
-25 -1: setDefaultAssertionStatus
-10 -1: ([BIIIII)V
-150 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-14 -1:    Inherited: 
-17 -1: fileTimeToWinTime
-7 -1: ([BI)[B
-26 -1: java/io/OutputStreamWriter
-58 -1: <T:Ljava/lang/Object;>(Ljava/util/ListIterator<+TT;>;I)TT;
-39 -1: sun/reflect/annotation/AnnotationParser
-71 -1: (Ljava/nio/file/Path;Ljava/lang/String;)Ljava/nio/file/DirectoryStream;
-47 -1: Ljava/util/concurrent/locks/ReentrantLock$Sync;
-44 -1: (Ljava/util/Collection;[Ljava/lang/Object;)Z
-43 -1: ([ILjava/util/function/IntBinaryOperator;)V
-29 -1: reverseAllValidSurrogatePairs
-20 -1: Ljava/nio/file/Path;
-20 -1: getGenericSignature0
-42 -1: (Ljava/lang/String;Ljava/lang/Class<*>;Z)V
-8 -1: manEntry
-64 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Lsun/misc/Resource;>;
-36 -1: newGetDoubleIllegalArgumentException
-63 -1: (Ljava/util/Collection;Ljava/lang/Class;)Ljava/util/Collection;
-30 -1:     Ergonomics Machine Class: 
-40 -1: ()Ljava/util/Map<Ljava/lang/String;TT;>;
-50 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuffer;
-30 -1: CHECK_MEMBER_ACCESS_PERMISSION
-22 -1: (Ljava/lang/Boolean;)I
-10 -1: V_Variable
-68 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedMappingTask
-61 -1: (Ljava/lang/String;IILjava/lang/String;)Ljava/nio/ByteBuffer;
-21 -1: accessClassInPackage.
-44 -1: java/util/WeakHashMap$WeakHashMapSpliterator
-11 -1: nextElement
-9 -1: separator
-48 -1: java/util/zip/ZipFile$ZipFileInflaterInputStream
-44 -1: java/security/UnresolvedPermissionCollection
-10 -1: access$900
-44 -1: java/util/ArraysParallelSortHelpers$FJDouble
-84 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
-52 -1: (Ljava/lang/ref/Finalizer;)Ljava/lang/ref/Finalizer;
-19 -1: getDeclaredMethods0
-29 -1: (IJ)Ljava/lang/StringBuilder;
-11 -1: Member.java
-61 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMBean;
-35 -1: java/lang/AssertionStatusDirectives
-23 -1: Declaring class is null
-56 -1: (Ljava/lang/Class;Ljava/lang/Object;Ljava/lang/Object;)I
-12 -1: java/io/File
-41 -1: java/util/ConcurrentModificationException
-47 -1: (Ljava/lang/CharSequence;)Ljava/nio/CharBuffer;
-19 -1: parameterClassCache
-8 -1: US_ASCII
-15 -1: tryMonitorEnter
-22 -1: Ljava/util/Collection;
-67 -1: (Lsun/misc/Signal;Lsun/misc/SignalHandler;)Lsun/misc/SignalHandler;
-27 -1: (Lsun/misc/JavaNioAccess;)V
-9 -1: DigitOnes
-5 -1: write
-31 -1: NF_internalMemberNameEnsureInit
-18 -1: comparableClassFor
-20 -1: defineAnonymousClass
-49 -1: (Ljava/io/InputStream;Lsun/net/ProgressSource;J)V
-31 -1: java/lang/NumberFormatException
-17 -1: remainderUnsigned
-62 -1: <T::Ljava/lang/Comparable<-TT;>;>()Ljava/util/Comparator<TT;>;
-4 -1: Kind
-20 -1: (Ljava/lang/Short;)I
-8 -1: OfDouble
-51 -1: ([Ljava/lang/Object;Ljava/lang/invoke/MethodType;)Z
-22 -1: [Ljava/util/Map$Entry;
-13 -1: instanceClass
-29 -1: ()Ljava/lang/SecurityManager;
-12 -1: isUnmappable
-17 -1: getAllStackTraces
-19 -1: LinkedValueIterator
-7 -1: isDigit
-10 -1: rangeCheck
-89 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-13 -1: getMethodType
-21 -1: FileOutputStream.java
-22 -1: ()Ljava/text/Collator;
-64 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;)TT;
-15 -1: defaultTimeZone
-14 -1: emptySortedMap
-35 -1: (Ljava/util/function/IntConsumer;)V
-45 -1: java/util/Collections$CheckedRandomAccessList
-11 -1: getPriority
-7 -1: signals
-6 -1: Subset
-15 -1: invokeInterface
-16 -1: nameRefsAreLegal
-38 -1: (Ljava/lang/Object;)Ljava/lang/Object;
-37 -1: Ljava/util/Collections$EmptyIterator;
-9 -1: Perf.java
-20 -1: java/math/BigInteger
-38 -1: java/util/WeakHashMap$ValueSpliterator
-71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetEncoder;
-50 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)V
-21 -1: [Ljava/lang/Class<*>;
-13 -1: getProperties
-63 -1: (Ljava/lang/Class<*>;[B[Ljava/lang/Object;)Ljava/lang/Class<*>;
-65 -1: (Ljava/util/Set<Ljava/lang/Class<*>;>;)[Ljava/lang/reflect/Field;
-21 -1: sun/util/calendar/Era
-21 -1: Ljava/nio/CharBuffer;
-23 -1: (Ljava/lang/Object;JS)V
-24 -1: oracle/jrockit/jfr/VMJFR
-15 -1: access allowed 
-34 -1: ()Lsun/util/calendar/CalendarDate;
-97 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-44 -1: ([Ljava/lang/Object;[Ljava/lang/Object;III)V
-48 -1: (Ljava/util/Collection;I)Ljava/util/Spliterator;
-11 -1: SimpleEntry
-63 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap;)V
-8 -1: putFloat
-20 -1: linkToCallSiteMethod
-8 -1: invokers
-35 -1: (J)Lsun/util/calendar/BaseCalendar;
-6 -1: FRENCH
-26 -1: getRawParameterAnnotations
-9 -1: wordIndex
-29 -1: JNI_COPY_FROM_ARRAY_THRESHOLD
-20 -1: sun/nio/cs/Surrogate
-48 -1: (Lsun/misc/JavaSecurityProtectionDomainAccess;)V
-45 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;I)V
-3 -1: NST
-14 -1: getHeaderField
-27 -1: (Ljava/util/jar/JarFile;Z)V
-10 -1: findNative
-38 -1: The following can be used with access:
-29 -1: convertCertArrayToSignerArray
-4 -1: .DSA
-12 -1: dependencies
-12 -1: SYNCHRONIZED
-14 -1: x-euc-jp-linux
-28 -1: URLStreamHandlerFactory.java
-11 -1: checkPtypes
-68 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
-13 -1: addDayOfMonth
-10 -1: isAncestor
-16 -1: entryDislocation
-12 -1: tableSizeFor
-29 -1: (ID)Ljava/lang/StringBuilder;
-19 -1: getLastRuleInstance
-24 -1: getGenericParameterTypes
-8 -1: ,offset=
-37 -1: (Ljava/net/URL;Ljava/lang/String;II)V
-13 -1: UTF_16LE.java
-12 -1: setTimestamp
-31 -1: AtomicReferenceFieldUpdaterImpl
-6 -1: L_URIC
-4 -1: (D)D
-14 -1: DeqSpliterator
-13 -1: LF_INVVIRTUAL
-171 -1: <U:Ljava/lang/Object;W:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;Ljava/lang/Class<TW;>;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TU;TW;>;
-4 -1: (D)I
-22 -1: Ljava/lang/Class<TT;>;
-4 -1: (D)J
-196 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: ,transitions=
-30 -1: (Lsun/net/www/MessageHeader;)I
-4 -1: (D)V
-12 -1: segmentShift
-4 -1: (D)Z
-14 -1: Reference.java
-26 -1: [Ljava/lang/reflect/Field;
-26 -1: java/nio/DirectByteBufferR
-31 -1: lambda$thenComparing$36697e65$1
-30 -1: (Lsun/net/www/MessageHeader;)V
-55 -1: No java.nio.charset.StandardCharsets instances for you!
-59 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;Ljava/lang/Object;)I
-19 -1: thenComparingDouble
-31 -1: ()Ljava/lang/invoke/LambdaForm;
-9 -1: getMillis
-21 -1: StandardCharsets.java
-15 -1: postDefineClass
-8 -1: getExtra
-3 -1: box
-10 -1: nextSetBit
-27 -1: java/util/ArrayList$SubList
-43 -1: (Ljava/util/concurrent/ConcurrentHashMap;)V
-52 -1: (Lsun/misc/URLClassPath;)Ljava/net/URLStreamHandler;
-7 -1: putLong
-40 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;)V
-8 -1: ([DII)[D
-8 -1: ([SIIS)I
-8 -1: argument
-12 -1: linkCallSite
-56 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<TT;>;
-15 -1: returnSlotCount
-68 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;Z)Ljava/lang/reflect/Method;
-20 -1: defaultDisplayLocale
-21 -1: (Ljava/util/Vector;)V
-49 -1: (Lsun/reflect/generics/visitor/TypeTreeVisitor;)V
-12 -1: isAlphabetic
-5 -1: perms
-13 -1: dosToJavaTime
-8 -1: ([SIIS)V
-7 -1: valueOf
-27 -1: Ljava/util/LinkedList$Node;
-41 -1: (Ljava/lang/String;I)Ljava/lang/Class<*>;
-38 -1: ()Ljava/nio/charset/CodingErrorAction;
-4 -1: MASK
-5 -1: Field
-101 -1: (Ljava/lang/Class;Ljava/nio/ByteBuffer;Lsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/Object;
-56 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
-9 -1: SURROGATE
-72 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)Ljava/lang/Object;
-19 -1: PARAMETER_MODIFIERS
-48 -1: ([Ljava/lang/Object;II)Ljava/util/stream/Stream;
-56 -1: (TK;TV;Ljava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
-118 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-29 -1: (Lsun/nio/ch/Interruptible;)V
-45 -1: Ljava/lang/ref/Reference<Ljava/lang/Object;>;
-17 -1: isHeldExclusively
-3 -1: NYI
-15 -1: getByteVolatile
-20 -1: compareAndSwapObject
-29 -1: (Z)[Ljava/lang/reflect/Field;
-7 -1: ([SII)V
-13 -1: toLanguageTag
-18 -1: StreamEncoder.java
-25 -1: (IF)Ljava/nio/ByteBuffer;
-18 -1: afterNodeInsertion
-11 -1: accessOrder
-60 -1: Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;
-20 -1: META-INF/MANIFEST.MF
-18 -1: getSuperInterfaces
-26 -1: (Ljava/nio/ByteBuffer;IZ)C
-26 -1: (Ljava/nio/ByteBuffer;IZ)D
-9 -1: PROTECTED
-18 -1:  not visible from 
-26 -1: java/lang/RuntimeException
-26 -1: (Ljava/nio/ByteBuffer;IZ)F
-20 -1: java/net/FileNameMap
-15 -1: insertArguments
-8 -1: diagprop
-26 -1: (Ljava/nio/ByteBuffer;IZ)I
-26 -1: (Ljava/nio/ByteBuffer;IZ)J
-20 -1: createContentHandler
-11 -1: getProtocol
-26 -1: (Ljava/nio/ByteBuffer;IZ)S
-33 -1: Ljava/lang/NoSuchMethodException;
-19 -1: entry name too long
-40 -1: java/util/jar/JarVerifier$VerifierStream
-6 -1: server
-7 -1: OCTOBER
-26 -1: sun/invoke/util/VerifyType
-6 -1: domain
-9 -1: getUnsafe
-5 -1: ([Z)I
-4 -1: cons
-42 -1: ()Ljava/lang/ReflectiveOperationException;
-4 -1: byte
-29 -1: java/util/function/BiConsumer
-24 -1: getJavaUtilZipFileAccess
-37 -1: ([Ljava/lang/Object;)Ljava/util/List;
-27 -1: timeout can not be negative
-62 -1: Ljava/util/Map<Ljava/io/InputStream;Ljava/util/zip/Inflater;>;
-16 -1: getOurStackTrace
-34 -1: (J)Ljava/lang/ref/Reference<+TT;>;
-50 -1: Lsun/reflect/generics/repository/MethodRepository;
-20 -1: MIN_BYTE_BUFFER_SIZE
-3 -1: buf
-13 -1: getAttributes
-6 -1: GERMAN
-38 -1: java/security/NoSuchAlgorithmException
-20 -1: Direct buffer memory
-6 -1: (IIZ)V
-27 -1: JVMTI_THREAD_STATE_RUNNABLE
-26 -1: [Ljava/io/File$PathStatus;
-36 -1: (Ljava/util/List;Ljava/lang/Class;)V
-13 -1: JarIndex.java
-34 -1: java/lang/Character$CharacterCache
-8 -1: csIBM857
-10 -1: LineReader
-28 -1: Ljava/lang/RuntimeException;
-30 -1: ()Ljava/util/Enumeration<TV;>;
-12 -1: getSeparator
-124 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-97 -1: Ljava/util/Map<Ljava/lang/Integer;Ljava/lang/ref/WeakReference<Ljava/nio/charset/CoderResult;>;>;
-21 -1: ConstantCallSite.java
-40 -1: sun/util/locale/provider/LocaleResources
-101 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
-4 -1: copy
-23 -1: sun/security/util/Debug
-10 -1: isAbsolute
-34 -1: (Ljava/lang/invoke/MethodHandle;)V
-34 -1: (Ljava/lang/invoke/MethodHandle;)Z
-48 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node;
-34 -1: (Lsun/reflect/LangReflectAccess;)V
-8 -1: csIBM862
-8 -1: csIBM866
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask
-39 -1: No java.util.Objects instances for you!
-68 -1: (Ljava/util/PrimitiveIterator$OfInt;JI)Ljava/util/Spliterator$OfInt;
-19 -1: Illegal class name 
-24 -1: uncaughtExceptionHandler
-12 -1: runFinalizer
-23 -1: java/io/FileInputStream
-41 -1: (Ljava/lang/Class<*>;Ljava/lang/String;)V
-98 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-30 -1: java/nio/charset/CoderResult$1
-20 -1: SourceDebugExtension
-30 -1: java/nio/charset/CoderResult$2
-69 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)Z
-14 -1: 1.8.0-internal
-16 -1: ReduceValuesTask
-13 -1: toLowerString
-14 -1: newPrintStream
-13 -1: unicodelittle
-19 -1: getClassLoadingLock
-9 -1: DigitTens
-80 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-12 -1: sun_eu_greek
-21 -1: getBootstrapClassPath
-9 -1: volatile 
-15 -1: UnmodifiableMap
-21 -1: enumConstantDirectory
-10 -1: getContent
-4 -1: cosh
-74 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
-11 -1: ([JII[JII)V
-28 -1: java/lang/reflect/Executable
-17 -1: MapReduceKeysTask
-6 -1: isOpen
-17 -1: AnnotationDefault
-17 -1: Already connected
-27 -1: (Lsun/misc/JavaNetAccess;)V
-34 -1: ([BILjava/nio/charset/Charset;Z)[B
-55 -1: Ljava/lang/invoke/DirectMethodHandle$EnsureInitialized;
-8 -1: Set.java
-10 -1: DEAD_ENTRY
-7 -1: nextInt
-3 -1: wtb
-23 -1: java/util/Collections$1
-86 -1: (Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/visitor/Reifier;
-23 -1: java/util/Collections$2
-23 -1: java/util/Collections$3
-18 -1: DoubleCumulateTask
-22 -1: skip value is negative
-85 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamDecoder;
-5 -1: \\[\\]$
-34 -1: Ljava/util/NoSuchElementException;
-3 -1: NaN
-30 -1: sun/util/calendar/CalendarDate
-10 -1: V_Constant
-20 -1: java/lang/Comparable
-9 -1: text/html
-20 -1: -9223372036854775808
-20 -1: DataInputStream.java
-20 -1:    Member defaults: 
-35 -1: Ljava/lang/ref/ReferenceQueue$Lock;
-8 -1: getBytes
-17 -1: CodePointIterator
-11 -1: Signal.java
-19 -1: javaHomePrefixCache
-12 -1: replaceFirst
-37 -1: Ljava/lang/IndexOutOfBoundsException;
-39 -1: (Ljava/lang/String;ZI)Ljava/lang/Class;
-21 -1: initSystemClassLoader
-28 -1: America/Indiana/Indianapolis
-47 -1: (Ljava/security/Permission;Ljava/lang/Object;)V
-27 -1: java/net/URISyntaxException
-21 -1: createSecurityManager
-7 -1: suspend
-12 -1: L_UNRESERVED
-17 -1: checkMemberAccess
-12 -1: CoreCounters
-19 -1: java/net/HttpCookie
-8 -1: isGetter
-17 -1: setDaylightSaving
-27 -1: java.launcher.javafx.error1
-53 -1: java/util/concurrent/ConcurrentHashMap$CollectionView
-16 -1: readUnsignedByte
-47 -1: (Ljava/lang/String;)Ljava/net/URLStreamHandler;
-40 -1: (Z)[Ljava/lang/reflect/Constructor<TT;>;
-14 -1: javaLangAccess
-5 -1: apply
-8 -1: getFloat
-15 -1: getD3DAvailable
-25 -1: startLocalManagementAgent
-7 -1: RUNTIME
-22 -1: LocalVariableTypeTable
-8 -1: doOutput
-16 -1: CheckedSortedSet
-10 -1: zoneOffset
-64 -1: (Ljava/security/Permission;)Ljava/security/PermissionCollection;
-13 -1: hasUnresolved
-13 -1: user.language
-11 -1: getDoubleAt
-14 -1: getQueueLength
-37 -1: java/nio/DirectByteBuffer$Deallocator
-6 -1: ASHIFT
-9 -1: checkPath
-80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)V
-6 -1: CENEXT
-16 -1: doubleToLongBits
-11 -1: copyToArray
-9 -1: copyField
-36 -1: ()Lsun/util/calendar/Gregorian$Date;
-53 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node<TK;TV;>;
-44 -1: (TK;TV;Ljava/lang/ref/ReferenceQueue<TV;>;)V
-35 -1: java/util/Collections$EmptyIterator
-38 -1: sealing violation: can't seal package 
-37 -1: (Ljava/util/Queue;Ljava/lang/Class;)V
-129 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)V
-18 -1: HashMapSpliterator
-8 -1: putShort
-23 -1: (Ljava/lang/Object;II)V
-7 -1: GERMANY
-13 -1: toTitleString
-102 -1: (Ljava/util/ArrayPrefixHelpers$CumulateTask;Ljava/util/function/BinaryOperator;[Ljava/lang/Object;II)V
-44 -1: ([Ljava/lang/Object;)Ljava/util/Spliterator;
-6 -1: unused
-25 -1: java/net/URLClassLoader$1
-25 -1: java/net/URLClassLoader$2
-25 -1: java/net/URLClassLoader$3
-25 -1: java/net/URLClassLoader$4
-12 -1: getFixedDate
-25 -1: java/net/URLClassLoader$5
-4 -1: time
-25 -1: java/net/URLClassLoader$6
-25 -1: java/net/URLClassLoader$7
-14 -1: historicalName
-12 -1: normalizeKey
-13 -1: MIN_SURROGATE
-41 -1: java/nio/charset/CharacterCodingException
-18 -1: java/lang/Iterable
-8 -1: ([JII)[J
-103 -1: Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-18 -1: putBooleanVolatile
-5 -1: Entry
-11 -1: CounterCell
-12 -1: monitorEnter
-10 -1: skipBuffer
-15 -1: hasMoreElements
-24 -1: newIllegalStateException
-24 -1: Ljava/lang/LinkageError;
-12 -1: getEntryFlag
-44 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;)V
-18 -1: java/nio/IntBuffer
-17 -1: jdk_minor_version
-28 -1: DIRECTIONALITY_RIGHT_TO_LEFT
-15 -1: getAndSetObject
-7 -1: sizeCtl
-15 -1: Ljava/util/Set;
-32 -1: (I)Ljava/lang/invoke/LambdaForm;
-16 -1: runFinalization0
-30 -1: Ljava/lang/reflect/Executable;
-15 -1: compareUnsigned
-5 -1: nkeys
-31 -1: Ljava/nio/channels/FileChannel;
-40 -1: sun/reflect/generics/tree/ClassSignature
-22 -1: (Ljava/lang/Object;I)B
-22 -1: (Ljava/lang/Object;I)C
-22 -1: (Ljava/lang/Object;I)D
-7 -1: JANUARY
-30 -1: newGetIllegalArgumentException
-22 -1: (Ljava/lang/Object;I)F
-22 -1: (Ljava/lang/Object;I)I
-22 -1: (Ljava/lang/Object;I)J
-28 -1: generateNamedFunctionInvoker
-38 -1: (Ljava/lang/String;)Ljava/time/ZoneId;
-19 -1: lambda$codePoints$2
-4 -1: Null
-7 -1: setEras
-15 -1: lambda$chars$15
-14 -1: CollectionView
-24 -1: (C)Ljava/io/PrintStream;
-22 -1: (Ljava/lang/Object;I)S
-96 -1: (Ljava/security/AccessControlContext;Lsun/security/util/Debug;Ljava/security/ProtectionDomain;)V
-17 -1: getJulianCalendar
-22 -1: (Ljava/lang/Object;I)V
-17 -1: getMethodAccessor
-9 -1: not owner
-35 -1: java/lang/reflect/ParameterizedType
-15 -1: ValueCollection
-22 -1: (Ljava/lang/Object;I)Z
-4 -1: utf8
-5 -1: CHINA
-9 -1: sprintf0d
-18 -1: java/nio/file/Path
-35 -1: DIRECTIONALITY_RIGHT_TO_LEFT_ARABIC
-30 -1: URI has an authority component
-43 -1: (Ljava/lang/Object;)Ljava/util/Spliterator;
-15 -1: <no principals>
-62 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale;
-6 -1: ([ZZ)V
-10 -1: getContext
-12 -1: content-type
-99 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;ILjava/util/WeakHashMap$Entry;)V
-51 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;)V
-27 -1: Invalid constant pool index
-20 -1: getUnicodeLocaleType
-43 -1: Ljava/nio/charset/CharacterCodingException;
-113 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap<Ljava/lang/String;Lsun/misc/URLClassPath$Loader;>;)V
-56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
-24 -1: Lsun/misc/SignalHandler;
-8 -1: readlink
-125 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
-11 -1: initStatics
-15 -1: unmappableCache
-13 -1: fixMethodType
-25 -1: sun/net/www/MessageHeader
-3 -1: cdt
-27 -1: Ljava/util/Locale$Category;
-59 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/lang/Object;
-8 -1: Accessor
-14 -1: mapLibraryName
-54 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/JarIndex;
-24 -1: ZoneOffsetTransitionRule
-7 -1: getChar
-3 -1: cee
-25 -1: MapReduceValuesToLongTask
-20 -1: declaredPublicFields
-44 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;)J
-13 -1: removeElement
-20 -1: Ljava/nio/ByteOrder;
-8 -1: parallel
-67 -1: (Ljava/lang/reflect/Constructor;Lsun/reflect/ConstructorAccessor;)V
-22 -1: java/util/zip/ZipCoder
-8 -1: ([ZIIZ)V
-45 -1: (Ljava/lang/String;Ljava/lang/CharSequence;)Z
-8 -1: february
-40 -1: java/util/zip/ZipFile$ZipFileInputStream
-47 -1: java/nio/charset/Charset$ExtendedProviderHolder
-13 -1: IEEEremainder
-15 -1: sun/misc/Perf$1
-9 -1: abstract 
-20 -1: ()Ljava/time/ZoneId;
-7 -1: ONE_DAY
-92 -1: (Ljava/util/concurrent/ConcurrentHashMap$Node;)Ljava/util/concurrent/ConcurrentHashMap$Node;
-45 -1: (Ljava/util/ListIterator;I)Ljava/lang/Object;
-16 -1: Buffer size <= 0
-9 -1: checkName
-11 -1: getJarEntry
-20 -1: Replacement too long
-53 -1: (Ljava/lang/String;)Ljava/nio/charset/CharsetDecoder;
-12 -1: isWhitespace
-15 -1: csISOLatinGreek
-70 -1: (Ljava/lang/reflect/Constructor<*>;Lsun/reflect/ConstructorAccessor;)V
-20 -1: TypeAnnotationTarget
-3 -1: No 
-27 -1: Lsun/reflect/FieldAccessor;
-12 -1: doPrivileged
-83 -1: (JLjava/util/function/ToIntFunction<-TV;>;ILjava/util/function/IntBinaryOperator;)I
-60 -1: (Ljava/nio/file/attribute/FileTime;)Ljava/util/zip/ZipEntry;
-11 -1: changeEntry
-18 -1: MessageHeader.java
-51 -1: ([Ljava/lang/String;Ljava/util/Map;)Ljava/util/Map;
-9 -1: castEntry
-16 -1: ACCESS_MODIFIERS
-11 -1: newInstance
-24 -1: lastIndexOfSupplementary
-13 -1: JZENTRY_EXTRA
-5 -1: LONGS
-7 -1: domain 
-16 -1: protocolPathProp
-21 -1: java/util/Hashtable$1
-10 -1: isSameDate
-23 -1: (I)Ljava/nio/file/Path;
-33 -1: java/util/PrimitiveIterator$OfInt
-7 -1: ([II)[I
-8 -1: variant=
-29 -1: (Ljava/util/Collection<*>;Z)Z
-38 -1:  already loaded in another classloader
-10 -1: setSeconds
-9 -1: makeShort
-59 -1: ClassLoader.findLibrary failed to return an absolute path: 
-26 -1: java/util/jar/JarException
-9 -1: setCharAt
-13 -1: initCauseFrom
-13 -1: val$fieldName
-18 -1: MIN_HIGH_SURROGATE
-60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)B
-25 -1: getDayOfWeekFromFixedDate
-10 -1: maybeReBox
-9 -1: getHandle
-60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)I
-59 -1: ([Ljava/lang/Class<*>;)Ljava/lang/reflect/Constructor<TT;>;
-3 -1: cis
-11 -1: getIssuerDN
-9 -1: codebase=
-80 -1: (ILjava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
-29 -1: addThreadDumpForSynchronizers
-6 -1: FRANCE
-77 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;ILjava/lang/Class<+[TT;>;)[TT;
-45 -1: <T:Ljava/lang/Object;>()Ljava/util/List<TT;>;
-16 -1: putFloatVolatile
-34 -1: (Ljava/lang/Class;)Ljava/util/Map;
-28 -1: ()Ljava/security/Permission;
-28 -1: (Ljava/lang/CharSequence;I)I
-51 -1: ()Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
-25 -1: (II)Ljava/nio/ByteBuffer;
-20 -1: BasicPermission.java
-5 -1: isNaN
-48 -1: (Ljava/lang/Throwable;)Ljava/lang/InternalError;
-10 -1: ONE_MINUTE
-55 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)J
-13 -1: DAYS_IN_MONTH
-7 -1: domains
-10 -1: isUnshared
-58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Long;>;
-47 -1: (Ljava/util/List;)Ljava/security/cert/CertPath;
-28 -1: ()Ljava/util/Enumeration<*>;
-34 -1: sun/misc/Launcher$ExtClassLoader$1
-22 -1: (CLjava/lang/Object;)Z
-64 -1: Ljava/lang/ref/WeakReference<Ljava/nio/charset/CharsetDecoder;>;
-7 -1: ENGLISH
-27 -1: (Ljava/util/zip/Inflater;)V
-24 -1: makeArrayElementAccessor
-72 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-48 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration;
-48 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-15 -1: getNthDayOfWeek
-16 -1: printHelpMessage
-15 -1: getAbsoluteFile
-9 -1: OPEN_READ
-19 -1: willGMTOffsetChange
-28 -1: (Ljava/util/LinkedHashMap;)V
-37 -1: java/security/AllPermissionCollection
-5 -1: [id="
-34 -1: java/lang/invoke/BoundMethodHandle
-31 -1: ()Ljava/security/cert/CertPath;
-50 -1: java/util/ArraysParallelSortHelpers$FJShort$Sorter
-14 -1: StaticAccessor
-22 -1: synchronizedCollection
-53 -1: ([Ljava/io/File;)Ljava/security/AccessControlContext;
-37 -1: (Ljava/lang/Class;Ljava/lang/Class;)Z
-14 -1: codePointCount
-13 -1:  is param at 
-37 -1: Ljava/lang/invoke/MemberName$Factory;
-20 -1: annotationDataOffset
-31 -1: protocol doesn't support output
-11 -1: hostAddress
-12 -1: ,dstSavings=
-35 -1: java.lang.Integer.IntegerCache.high
-15 -1: ParallelLoaders
-48 -1: (Ljava/util/Locale;)Lsun/util/locale/BaseLocale;
-8 -1: getSize0
-22 -1: checkCreateClassLoader
-8 -1: transfer
-32 -1: (Lsun/misc/JavaSecurityAccess;)V
-26 -1: ()Ljava/net/URLConnection;
-3 -1: cmp
-9 -1: setMillis
-34 -1: sun/util/calendar/AbstractCalendar
-19 -1: getDirectBufferPool
-7 -1: ([FII)V
-28 -1: ([C)Ljava/lang/StringBuffer;
-54 -1: (Ljava/lang/Class<*>;)Ljava/security/ProtectionDomain;
-26 -1: (Ljava/nio/ByteBuffer;IF)V
-11 -1: discardMark
-71 -1: (Ljava/lang/Class;)Lsun/util/locale/provider/LocaleServiceProviderPool;
<